RAB18 Antikörper

Produktnummer ABIN4952337

Produktdetails anti-RAB18 Antikörper

Target: RAB18 (RAB18, Member RAS Oncogene Family (RAB18))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RAB18 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Antigen affinity

Immunogen: Amino acids DGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREE of human RAB18 were used as the immunogen for the RAB18 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the RAB18 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the RAB18 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu RAB18

Target: RAB18 (RAB18, Member RAS Oncogene Family (RAB18))

Andere Bezeichnung: RAB18 (RAB18 Produkte)

Synonyme: RAB18LI1 antikoerper, WARBM3 antikoerper, AA959686 antikoerper, RAB18 antikoerper, rab18li1 antikoerper, LOC100219058 antikoerper, rab18 antikoerper, zgc:92523 antikoerper, fc62e07 antikoerper, wu:fc62e07 antikoerper, zgc:77145 antikoerper, RAB18, member RAS oncogene family antikoerper, ras-related protein Rab-18-B antikoerper, ras-related protein Rab-18-like antikoerper, Ras-related protein Rab-18 antikoerper, RAB18, member RAS oncogene family S homeolog antikoerper, RAB18B, member RAS oncogene family antikoerper, RAB18A, member RAS oncogene family antikoerper, RAB18 antikoerper, Rab18 antikoerper, rab18 antikoerper, LOC100219058 antikoerper, rab-18 antikoerper, rab18.S antikoerper, rab18b antikoerper, rab18a antikoerper

Hintergrund: Ras-related protein Rab-18 is a protein that in humans is encoded by the RAB18 gene. It is a ubiquitously expressed protein with particularly high expression in the brain. The protein encoded by this gene is a member of a family of Ras-related small GTPases that regulate membrane trafficking in organelles and transport vesicles. Knockdown studies in zebrafish suggest that this protein may have a role in eye and brain development. Mutations in this gene are associated with Warburg micro syndrome type 3. Alternatively spliced transcript variants have been found for this gene.

UniProt: Q9NP72

Pathways: SARS-CoV-2 Protein Interaktom