PTP4A2 Antikörper

Produktnummer ABIN4952318

Produktdetails anti-PTP4A2 Antikörper

Target: PTP4A2 (Protein tyrosine Phosphatase Type IVA, Member 2 (PTP4A2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PTP4A2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS)

Aufreinigung: Antigen affinity

Immunogen: Amino acids TTLVRVCDATYDKAPVEKEGIHVLDWPFDD of human PTP4A2 were used as the immunogen for the PTP4A2 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the PTP4A2 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL,FACS: 1-3 μg/10^6 cells

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the PTP4A2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu PTP4A2

Target: PTP4A2 (Protein tyrosine Phosphatase Type IVA, Member 2 (PTP4A2))

Andere Bezeichnung: PTP4A2 (PTP4A2 Produkte)

Synonyme: wu:fc05f09 antikoerper, wu:fi84b06 antikoerper, zgc:101724 antikoerper, MGC53390 antikoerper, MGC80084 antikoerper, MGC132077 antikoerper, PTP4A2 antikoerper, ptp4a2 antikoerper, Prl-2 antikoerper, HH13 antikoerper, HH7-2 antikoerper, HU-PP-1 antikoerper, OV-1 antikoerper, PRL-2 antikoerper, PRL2 antikoerper, PTP4A antikoerper, PTPCAAX2 antikoerper, ptp-IV1a antikoerper, ptp-IV1b antikoerper, protein tyrosine phosphatase type IVA, member 2b antikoerper, protein tyrosine phosphatase 4a2 antikoerper, protein tyrosine phosphatase type IVA, member 2 antikoerper, protein tyrosine phosphatase type IVA, member 2 L homeolog antikoerper, ptp4a2b antikoerper, ptp4a2 antikoerper, PTP4A2 antikoerper, ptp4a2.L antikoerper, Ptp4a2 antikoerper

Hintergrund: Protein tyrosine phosphatase type IVA 2 is an enzyme that in humans is encoded by the PTP4A2 gene. The protein encoded by this gene belongs to a small class of the protein tyrosine phosphatase (PTP) family. PTPs are cell signaling molecules that play regulatory roles in a variety of cellular processes. PTPs in this class contain a protein tyrosine phosphatase catalytic domain and a characteristic C-terminal prenylation motif. This PTP has been shown to primarily associate with plasmic and endosomal membrane through its C-terminal prenylation. This PTP was found to interact with the beta-subunit of Rab geranylgeranyltransferase II (beta GGT II), and thus may function as a regulator of GGT II activity. Overexpression of this gene in mammalian cells conferred a transformed phenotype, which suggested its role in tumorigenesis. Alternatively spliced transcript variants have been described. Related pseudogenes exist on chromosomes 11, 12 and 17.

UniProt: Q12974