Peroxiredoxin 4 Antikörper

Produktnummer ABIN4952125

Produktdetails anti-Peroxiredoxin 4 Antikörper

Target: Peroxiredoxin 4 (PRDX4)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Peroxiredoxin 4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunocytochemistry (ICC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity

Immunogen: Amino acids SDLTHQISKDYGVYLEDSGHTLRGLFIIDDK of human Peroxiredoxin 4 were used as the immunogen for the Peroxiredoxin 4 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the Peroxiredoxin 4 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL,ICC: 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the Peroxiredoxin 4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu Peroxiredoxin 4

Target: Peroxiredoxin 4 (PRDX4)

Andere Bezeichnung: Peroxiredoxin 4 / PRDX4 (PRDX4 Produkte)

Synonyme: MGC82793 antikoerper, prdx4 antikoerper, MGC79732 antikoerper, PRDX4 antikoerper, AOE37-2 antikoerper, PRX-4 antikoerper, AOE372 antikoerper, Prx-iv antikoerper, Prx4 antikoerper, TRANK antikoerper, fb59c09 antikoerper, wu:fb59c09 antikoerper, zgc:162938 antikoerper, peroxiredoxin 4 antikoerper, peroxiredoxin 4 L homeolog antikoerper, PRDX4 antikoerper, prdx4.L antikoerper, prdx4 antikoerper, Prdx4 antikoerper

Hintergrund: PRDX4 (Peroxiredoxin 4) is also known as AOE37-2. The protein encoded by this gene is an antioxidant enzyme and belongs to the peroxiredoxin family. Functional analysis showed that PRDX4 protects glutamine synthetase from inactivation. Yeast 2-hybrid, immunoprecipitation, and immunoblot analyses indicated that PRDX4 and PRDX1 are capable of homodimerization and heterodimerization with each other but not with the mitochondrial PRDX3. Gel mobility shift and immunoblot analysis found that PRDX4 depletes NFKB binding activity together with a reduction in the amounts of p50, p65, and phosphorylated IKBA, as well as a reduction in the expression of HIV-1 viral proteins. Expression of PRDX4, alone or with PRDX1, increased the resistance of yeast cells to oxidant-induced toxicity. Jin et al. suggested PRDX4 modulates IKBA phosphorylation in the cytoplasm and thus affects a peroxiredoxin-dependent redox step.

UniProt: Q13162