F2RL1 Antikörper

Produktnummer ABIN4952050

Produktdetails anti-F2RL1 Antikörper

Target: F2RL1 (Coagulation Factor II (thrombin) Receptor-Like 1 (F2RL1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser F2RL1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Antigen affinity

Immunogen: Amino acids HDFRDHAKNALLCRSVRTVKQMQVSLTSKKHSRKS of human F2RL1/PAR2 were used as the immunogen for the PAR2 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the PAR2 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the PAR2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu F2RL1

Target: F2RL1 (Coagulation Factor II (thrombin) Receptor-Like 1 (F2RL1))

Andere Bezeichnung: PAR2 / F2RL1 / Thrombin Receptor-like 1 (F2RL1 Produkte)

Synonyme: par2 antikoerper, GPR11 antikoerper, PAR2 antikoerper, Gpcr11 antikoerper, PAR-2 antikoerper, Par2 antikoerper, Par-2 antikoerper, Proteinase-activated receptor 2 antikoerper, F2R like trypsin receptor 1 antikoerper, coagulation factor II (thrombin) receptor-like 1 antikoerper, par2 antikoerper, F2RL1 antikoerper, F2rl1 antikoerper

Hintergrund: Protease activated receptor 2 (PAR2), also known ascoagulation factor II (thrombin) receptor-like 1 (F2RL1) or G-protein coupled receptor 11 (GPR11), is a protein that in humans is encoded by the F2RL1 gene. F2RL1 is a member of the large family of 7-transmembrane-region receptors that couple to guanosine-nucleotide-binding proteins. F2RL1 is also a member of the protease-activated receptor family. It is activated by trypsin, but not by thrombin. It is activated by proteolytic cleavage of its extracellular amino terminus. The new amino terminus functions as a tethered ligand and activates the receptor. The F2RL1 gene contains two exons and is widely expressed in human tissues. Additionally, PAR2 modulates inflammatory responses and acts as a sensor for proteolytic enzymes generated during infection.

UniProt: P55085

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response, SARS-CoV-2 Protein Interaktom