PCSK6 Antikörper

Produktnummer ABIN4952032

Produktdetails anti-PCSK6 Antikörper

Target: PCSK6 (Proprotein Convertase Subtilisin/kexin Type 6 (PCSK6))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PCSK6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Antigen affinity

Immunogen: Amino acids RNPEKQGKLKEWSLILYGTAEHPYHTFSAHQSRSRMLE of human PCSK6/PACE4 were used as the immunogen for the PACE4 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the PACE4 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the PACE4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu PCSK6

Target: PCSK6 (Proprotein Convertase Subtilisin/kexin Type 6 (PCSK6))

Andere Bezeichnung: PCSK6 / PACE4 (PCSK6 Produkte)

Synonyme: PACE4 antikoerper, PCSK6 antikoerper, SPC4 antikoerper, C86343 antikoerper, Pace4 antikoerper, Spc4 antikoerper, PACE4AIIa antikoerper, Xpace4 antikoerper, spc4 antikoerper, proprotein convertase subtilisin/kexin type 6 antikoerper, peptidase S8 antikoerper, proprotein convertase subtilisin/kexin type 6 L homeolog antikoerper, PCSK6 antikoerper, EAMY_RS27925 antikoerper, pcsk6 antikoerper, Pcsk6 antikoerper, pcsk6.L antikoerper

Hintergrund: Proprotein convertase subtilisin/kexin type 6 is an enzyme that in humans is encoded by the PCSK6 gene. This gene encodes a member of the subtilisin-like proprotein convertase family, which includes proteases that process protein and peptide precursors trafficking through regulated or constitutive branches of the secretory pathway. The encoded protein undergoes an initial autocatalytic processing event in the ER to generate a heterodimer which exits the ER and sorts to the trans-Golgi network where a second autocatalytic event takes place and the catalytic activity is acquired. The encoded protease is constitutively secreted into the extracellular matrix and expressed in many tissues, including neuroendocrine, liver, gut, and brain. This gene encodes one of the seven basic amino acid-specific members which cleave their substrates at single or paired basic residues. Some of its substrates include transforming growth factor beta related proteins, proalbumin, and von Willebrand factor. This gene is thought to play a role in tumor progression and left-right patterning. Alternatively spliced transcript variants encoding different isoforms have been identified.

UniProt: P29122

Pathways: Neurotrophin Signalübertragung, SARS-CoV-2 Protein Interaktom