NDRG2 Antikörper
-
- Target Alle NDRG2 Antikörper anzeigen
- NDRG2 (NDRG Family Member 2 (NDRG2))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NDRG2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Aufreinigung
- Antigen affinity
- Immunogen
- Amino acids NSELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFER of human NDRG2 were used as the immunogen for the NDRG2 antibody.
- Isotyp
- IgG
- Top Product
- Discover our top product NDRG2 Primärantikörper
-
anti-NDRG Family Member 2 (NDRG2) (AA 1-96) antibody
NDRG2 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 6A5 unconjugated
anti-NDRG Family Member 2 (NDRG2) antibodyNDRG2 Reaktivität: Human, Maus, Ratte WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-NDRG Family Member 2 (NDRG2) (AA 1-360) antibodyNDRG2 Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-NDRG Family Member 2 (NDRG2) (N-Term) antibodyVerified NDRG2 Reaktivität: Human, Maus, Ratte WB, ELISA, IHC Wirt: Ziege Polyclonal unconjugated
anti-NDRG Family Member 2 (NDRG2) (AA 152-371) antibodyNDRG2 Reaktivität: Human WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-NDRG Family Member 2 (NDRG2) (AA 1-96) antibodyNDRG2 Reaktivität: Human WB, ELISA Wirt: Maus Polyclonal unconjugated
anti-NDRG Family Member 2 (NDRG2) (C-Term) antibodyNDRG2 Reaktivität: Human, Maus, Ratte WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-NDRG Family Member 2 (NDRG2) (C-Term) antibodyNDRG2 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Schwein, Pferd, Kaninchen, Affe, Xenopus laevis WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-NDRG Family Member 2 (NDRG2) (AA 2-300) antibodyNDRG2 Reaktivität: Ratte WB, IHC, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-NDRG Family Member 2 (NDRG2) (C-Term) antibodyNDRG2 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Schwein, Hund, Pferd, Meerschweinchen, Kaninchen WB, IHC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
- Optimal dilution of the NDRG2 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Lagerung
- -20 °C
- Informationen zur Lagerung
- After reconstitution, the NDRG2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- NDRG2 (NDRG Family Member 2 (NDRG2))
- Andere Bezeichnung
- NDRG2 (NDRG2 Produkte)
- Synonyme
- NDRG2 antikoerper, AI182517 antikoerper, AU040374 antikoerper, Ndr2 antikoerper, SYLD antikoerper, im:6909381 antikoerper, si:dkey-88n24.1 antikoerper, zgc:101847 antikoerper, NDRG family member 2 antikoerper, N-myc downstream regulated gene 2 antikoerper, NDRG family member 2 S homeolog antikoerper, ndrg2 antikoerper, NDRG2 antikoerper, Ndrg2 antikoerper, ndrg2.S antikoerper
- Hintergrund
- NDRG2 contributes to the regulation of the Wnt signaling pathway. Down-regulates CTNNB1-mediated transcriptional activation of target genes, such as CCND1, and may thereby act as tumor suppressor. May be involved in dendritic cell and neuron differentiation. [UniProt]
- UniProt
- Q9UN36
-
