MGST1 Antikörper

Produktnummer ABIN4951723

Produktdetails anti-MGST1 Antikörper

Target: MGST1 (Microsomal Glutathione S-Transferase 1 (MGST1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MGST1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Antigen affinity

Immunogen: Amino acids KVFANPEDCVAFGKGENAKKYLRTDDRVERVRRA of human MGST1 were used as the immunogen for the MGST1 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the MGST1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the MGST1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu MGST1

Target: MGST1 (Microsomal Glutathione S-Transferase 1 (MGST1))

Andere Bezeichnung: MGST1 (MGST1 Produkte)

Synonyme: gst12 antikoerper, mgst antikoerper, mgst-i antikoerper, zgc:101898 antikoerper, MGST1 antikoerper, GST12 antikoerper, MGST antikoerper, MGST-I antikoerper, 1500002K10Rik antikoerper, Gst antikoerper, microsomal glutathione S-transferase 1 L homeolog antikoerper, microsomal glutathione S-transferase 1.1 antikoerper, microsomal glutathione S-transferase 1 pseudogene antikoerper, microsomal glutathione S-transferase 1 antikoerper, mgst1.L antikoerper, mgst1.1 antikoerper, LOC473380 antikoerper, MGST1 antikoerper, mgst1 antikoerper, CpipJ_CPIJ015233 antikoerper, CpipJ_CPIJ018241 antikoerper, Mgst1 antikoerper

Hintergrund: Microsomal glutathione S-transferase 1 is an enzyme that in humans is encoded by the MGST1 gene. The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family consists of six human proteins, two of which are involved in the production of leukotrienes and prostaglandin E, important mediators of inflammation. Other family members, demonstrating glutathione S-transferase and peroxidase activities, are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. This gene encodes a protein that catalyzes the conjugation of glutathione to electrophiles and the reduction of lipid hydroperoxides. This protein is localized to the endoplasmic reticulum and outer mitochondrial membrane where it is thought to protect these membranes from oxidative stress. Several transcript variants, some non-protein coding and some protein coding, have been found for this gene.

UniProt: P10620