KERA Antikörper

Produktnummer ABIN4951537

Produktdetails anti-KERA Antikörper

Target: KERA (Keratocan (KERA))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KERA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Antigen affinity

Immunogen: Amino acids YLQNNLIETIPEKPFENATQLRWINLNKNKITN of human Keratocan were used as the immunogen for the Keratocan antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the Keratocan antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the Keratocan antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu KERA

Target: KERA (Keratocan (KERA))

Andere Bezeichnung: Keratocan (KERA Produkte)

Synonyme: KERA antikoerper, si:dkeyp-38g8.3 antikoerper, zgc:136259 antikoerper, CNA2 antikoerper, SLRR2B antikoerper, keratocan antikoerper, KERA antikoerper, kera antikoerper, Kera antikoerper

Hintergrund: Keratocan (KTN), also known as keratan sulfate proteoglycan keratocan, is a protein that in humans is encoded by the KERA gene. It is mapped to 12q22. The protein encoded by this gene is a keratan sulfate proteoglycan that is involved in corneal transparency. Defects in this gene are a cause of autosomal recessive cornea plana 2 (CNA2). Keratan sulfate proteoglycans (KSPGs) are members of the small leucine-rich proteoglycan (SLRP) family. KSPGs, particularly keratocan, lumican and mimecan, are important to the transparency of the cornea.

UniProt: O60938

Pathways: Glycosaminoglycan Metabolic Process