KCNIP2 Antikörper

Produktnummer ABIN4951519

Produktdetails anti-KCNIP2 Antikörper

Target: KCNIP2 (Kv Channel Interacting Protein 2 (KCNIP2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCNIP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity

Immunogen: Amino acids DEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYR of human KChIP2 were used as the immunogen for the KChIP2 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the KChIP2 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the KChIP2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu KCNIP2

Target: KCNIP2 (Kv Channel Interacting Protein 2 (KCNIP2))

Andere Bezeichnung: KChIP2 (KCNIP2 Produkte)

Synonyme: KCHIP2 antikoerper, KCNIP2 antikoerper, Kchip2 antikoerper, KChIP2 antikoerper, kchip2 antikoerper, si:ch73-173h19.2 antikoerper, potassium voltage-gated channel interacting protein 2 antikoerper, Kv channel-interacting protein 2 antikoerper, Kv channel interacting protein 2 S homeolog antikoerper, Kv channel interacting protein 2 antikoerper, KCNIP2 antikoerper, Kcnip2 antikoerper, kcnip2.S antikoerper, kcnip2 antikoerper

Hintergrund: Kv channel-interacting protein 2 also known as KChIP2 is a protein that in humans is encoded by the KCNIP2 gene. This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins, which belong to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. And they are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Alternative splicing results in multiple transcript variant encoding different isoforms.

UniProt: Q9NS61