Involucrin Antikörper
-
- Target Alle Involucrin (IVL) Antikörper anzeigen
- Involucrin (IVL)
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Involucrin Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Antigen affinity
- Immunogen
- Amino acids QVQDIQPALPTKGEVLLPVEHQQQKQEVQWPPKHK of human Involucrin were used as the immunogen for the Involucrin antibody.
- Isotyp
- IgG
- Top Product
- Discover our top product IVL Primärantikörper
-
-
- Applikationshinweise
- Optimal dilution of the Involucrin antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Lagerung
- -20 °C
- Informationen zur Lagerung
- After reconstitution, the Involucrin antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- Involucrin (IVL)
- Andere Bezeichnung
- Involucrin (IVL Produkte)
- Synonyme
- INV antikoerper, NPH2 antikoerper, NPHP2 antikoerper, 1110019C06Rik antikoerper, IVL antikoerper, Nphp2 antikoerper, inv antikoerper, involucrin antikoerper, inversin antikoerper, IVL antikoerper, INVS antikoerper, Ivl antikoerper, Invs antikoerper
- Hintergrund
- Involucrin is a protein component of human skin and in humans is encoded by the IVL gene. It is a highly reactive, soluble, transglutaminase substrate protein present in keratinocytes of epidermisand other stratified squamous epithelia. It first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase thus helping in the formation of an insoluble envelope beneath the plasma membrane functioning as a glutamyl donor during assembly of the cornified envelope. Additionally, Involucrin is synthesised in the stratum spinosum and cross linked in the stratum granulosum by the transglutaminase enzyme that makes it highly stable. Thus it provides structural support to the cell, thereby allowing the cell to resist invasion by micro-organisms.
- UniProt
- P07476
-