IGFBPI Antikörper

Produktnummer ABIN4951423

Produktdetails anti-IGFBPI Antikörper

Target: IGFBPI (Insulin-Like Growth Factor Binding Protein 1 (IGFBPI))

Reaktivität: Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IGFBPI Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), ELISA

Aufreinigung: Antigen affinity

Immunogen: Amino acids REIADLKKWKEPCQRELYKVLERLAAAQQKA of mouse IGFBP1 were used as the immunogen for the IGFBP1antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the IGFBP1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,ELISA : 0.1-0.5 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the IGFBP1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu IGFBPI

Target: IGFBPI (Insulin-Like Growth Factor Binding Protein 1 (IGFBPI))

Andere Bezeichnung: IGFBP1 (IGFBPI Produkte)

Synonyme: cb656 antikoerper, igfbp1 antikoerper, IGFBP-1 antikoerper, MGC68538 antikoerper, afbp antikoerper, ibp1 antikoerper, pp12 antikoerper, igf-bp25 antikoerper, higfbp-1 antikoerper, IGFBP1 antikoerper, LOC100223208 antikoerper, LOC100305121 antikoerper, AFBP antikoerper, IBP1 antikoerper, IGF-BP25 antikoerper, PP12 antikoerper, hIGFBP-1 antikoerper, IGFBA antikoerper, insulin like growth factor binding protein 1 antikoerper, insulin-like growth factor binding protein 1a antikoerper, insulin like growth factor binding protein 1 S homeolog antikoerper, insulin like growth factor binding protein 1 L homeolog antikoerper, insulin-like growth factor binding protein 1 antikoerper, IGFBP1 antikoerper, igfbp1a antikoerper, igfbp1.S antikoerper, igfbp1.L antikoerper, igfbp1 antikoerper, LOC100305121 antikoerper, Igfbp1 antikoerper

Hintergrund: IGFBP1, Insulin-like growth factor-binding protein 1, also known as placental protein 12 (PP12), is a protein that in humans is encoded by the IGFBP1 gene. The IGFBP1 gene has 4 exons and spans 5.9 kb. And the IGFBP1gene is localized to 7p13-p12 by in situ hybridization. This gene is a member of the Insulin-like growth factor-binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a type-I thyroglobulin domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

UniProt: P47876

Pathways: Myometrial Relaxation and Contraction, ER-Nucleus Signaling, Growth Factor Binding