ICA1 Antikörper

Produktnummer ABIN4951392

Produktdetails anti-ICA1 Antikörper

Target: ICA1 (Islet Cell Autoantigen 1, 69kDa (ICA1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ICA1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Antigen affinity

Immunogen: Amino acids EKTSHTMAAIHESFKGYQPYEFTTLKSLQDPMKK of human ICA1 were used as the immunogen for the ICA1 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the ICA1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the ICA1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu ICA1

Target: ICA1 (Islet Cell Autoantigen 1, 69kDa (ICA1))

Andere Bezeichnung: ICA1 (ICA1 Produkte)

Synonyme: ica1 antikoerper, MGC52730 antikoerper, ICA1 antikoerper, DKFZp469G0321 antikoerper, zgc:92566 antikoerper, 69kDa antikoerper, ICA69 antikoerper, Ica69 antikoerper, MGC83241 antikoerper, ICAp69 antikoerper, islet cell autoantigen 1 L homeolog antikoerper, islet cell autoantigen 1 antikoerper, Islet cell autoantigen 1 antikoerper, islet cell autoantigen 1 S homeolog antikoerper, ica1.L antikoerper, ICA1 antikoerper, ica1 antikoerper, ica69 antikoerper, Ica1 antikoerper, ica1.S antikoerper

Hintergrund: Islet cell autoantigen 1 is a protein that in humans is encoded by the ICA1 gene. It is mapped to 7p22. This gene encodes a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. What's more, this protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome. Several transcript variants encoding two different isoforms have been found for this gene.

UniProt: Q05084