-
- Target Alle HKDC1 Antikörper anzeigen
- HKDC1 (Hexokinase Domain Containing 1 (HKDC1))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HKDC1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Antigen affinity
- Immunogen
- Amino acids KRHVQMESQFYPTPNEIIRGNGTELFEYVADCLAD of human HKDC1 were used as the immunogen for the HKDC1 antibody.
- Isotyp
- IgG
- Top Product
- Discover our top product HKDC1 Primärantikörper
-
anti-Hexokinase Domain Containing 1 (HKDC1) (AA 129-427) antibody
HKDC1 Reaktivität: Human WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Hexokinase Domain Containing 1 (HKDC1) (AA 102-200) antibodyHKDC1 Reaktivität: Human WB, ELISA, IF Wirt: Maus Monoclonal 4E8 unconjugated
anti-Hexokinase Domain Containing 1 (HKDC1) (AA 1-427) antibodyHKDC1 Reaktivität: Human ELISA, IP Wirt: Maus Monoclonal 3A2 unconjugated
anti-Hexokinase Domain Containing 1 (HKDC1) antibodyHKDC1 Reaktivität: Ratte, Maus WB Wirt: Kaninchen Polyclonal unconjugated
anti-Hexokinase Domain Containing 1 (HKDC1) (AA 825-853), (C-Term) antibodyHKDC1 Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB35910 unconjugated
anti-Hexokinase Domain Containing 1 (HKDC1) (AA 102-200) antibodyHKDC1 Reaktivität: Human WB, ELISA Wirt: Maus Polyclonal unconjugated
anti-Hexokinase Domain Containing 1 (HKDC1) (AA 1-427) antibodyHKDC1 Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-Hexokinase Domain Containing 1 (HKDC1) (AA 150-250) antibodyHKDC1 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
- Optimal dilution of the HKDC1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Lagerung
- -20 °C
- Informationen zur Lagerung
- After reconstitution, the HKDC1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- HKDC1 (Hexokinase Domain Containing 1 (HKDC1))
- Andere Bezeichnung
- HKDC1 (HKDC1 Produkte)
- Synonyme
- cb370 antikoerper, sb:cb370 antikoerper, HKDC1 antikoerper, BC016235 antikoerper, hexokinase domain containing 1 antikoerper, putative hexokinase HKDC1 antikoerper, hkdc1 antikoerper, HKDC1 antikoerper, LOC100088018 antikoerper, Hkdc1 antikoerper
- Hintergrund
- HKDC1 (hexokinase domain containing 1) is a protein that belongs to the hexokinase family and functions to catalyze the ATP-dependent conversion of D-hexose to D-hexose 6-phosphate.
- UniProt
- Q2TB90
-
Sie sind hier:
