FMO1 Antikörper
-
- Target Alle FMO1 Antikörper anzeigen
- FMO1 (Flavin Containing Monooxygenase 1 (FMO1))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FMO1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Antigen affinity
- Immunogen
- Amino acids AFPFLDESVVKVEDGQASLYKYIFPAHLQK of human FMO1 were used as the immunogen for the FMO1 antibody.
- Isotyp
- IgG
- Top Product
- Discover our top product FMO1 Primärantikörper
-
-
- Applikationshinweise
- Optimal dilution of the FMO1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Lagerung
- -20 °C
- Informationen zur Lagerung
- After reconstitution, the FMO1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- FMO1 (Flavin Containing Monooxygenase 1 (FMO1))
- Andere Bezeichnung
- FMO1 (FMO1 Produkte)
- Synonyme
- RFMO1A antikoerper, flavin containing monooxygenase 1 antikoerper, FMO1 antikoerper, fmo1 antikoerper, Fmo1 antikoerper
- Hintergrund
- Metabolic N-oxidation of the diet-derived amino-trimethylamine (TMA) is mediated by flavin-containing monooxygenase and is subject to an inherited FMO3 polymorphism in man resulting in a small subpopulation with reduced TMA N-oxidation capacity resulting in fish odor syndrome Trimethylaminuria. Three forms of the enzyme, FMO1 found in fetal liver, FMO2 found in adult liver, and FMO3 are encoded by genes clustered in the 1q23-q25 region. Flavin-containing monooxygenases are NADPH-dependent flavoenzymes that catalyzes the oxidation of soft nucleophilic heteroatom centers in drugs, pesticides, and xenobiotics. Several transcript variants encoding different isoforms have been found for this gene.
- UniProt
- Q01740
-