FABP2 (Intestinal) Antikörper

Produktnummer ABIN4950974

Produktdetails

Target: FABP2 (Intestinal)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Applikation: Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)

Aufreinigung: Antigen affinity

Immunogen: Amino acids AFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLK from the human protein were used as the immunogen for the FABP2 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the FABP2 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (FFPE): 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the FABP2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Antigendetails

Target: FABP2 (Intestinal)

Hintergrund: FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. FABP2 is probably involved in triglyceride-rich lipoprotein synthesis. Binds saturated long-chain fatty acids with a high affinity, but binds with a lower affinity to unsaturated long-chain fatty acids. FABP2 may also help maintain energy homeostasis by functioning as a lipid sensor. [UniProt]

UniProt: P12104