EWSR1 Antikörper

Produktnummer ABIN4950965

Produktdetails anti-EWSR1 Antikörper

Target: EWSR1 (Ewing Sarcoma Breakpoint Region 1 (EWSR1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EWSR1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunocytochemistry (ICC), Immunohistochemistry (Frozen Sections) (IHC (fro))

Aufreinigung: Antigen affinity

Immunogen: Amino acids NDSVTLDDLADFFKQCGVVKMNKRTGQPMIH of human EWSR1 were used as the immunogen for the EWSR1 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the EWSR1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL,IHC (Frozen): 1-2 μg/mL,ICC (FFPE): 1-2 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the EWSR1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu EWSR1

Target: EWSR1 (Ewing Sarcoma Breakpoint Region 1 (EWSR1))

Andere Bezeichnung: EWS / EWSR1 (EWSR1 Produkte)

Synonyme: EWS antikoerper, bK984G1.4 antikoerper, AU018891 antikoerper, Ews antikoerper, Ewsh antikoerper, EWSR1 antikoerper, fc04c01 antikoerper, wu:fc04c01 antikoerper, DKFZp459K1116 antikoerper, ewsr1 antikoerper, ewsr1.S antikoerper, fb40b11 antikoerper, fusl antikoerper, wu:fb40b11 antikoerper, wu:fb75g09 antikoerper, zgc:55864 antikoerper, EWS RNA binding protein 1 antikoerper, Ewing sarcoma breakpoint region 1 antikoerper, EWS RNA-binding protein 1 antikoerper, EWS RNA-binding protein 1a antikoerper, EWS RNA binding protein 1 L homeolog antikoerper, EWS RNA-binding protein 1b antikoerper, EWSR1 antikoerper, Ewsr1 antikoerper, ewsr1a antikoerper, ewsr1 antikoerper, ewsr1.L antikoerper, ewsr1b antikoerper

Hintergrund: This gene encodes a multifunctional protein that is involved in various cellular processes, including gene expression, cell signaling, and RNA processing and transport. The protein includes an N-terminal transcriptional activation domain and a C-terminal RNA-binding domain. Chromosomal translocations between this gene and various genes encoding transcription factors result in the production of chimeric proteins that are involved in tumorigenesis. These chimeric proteins usually consist of the N-terminal transcriptional activation domain of this protein fused to the C-terminal DNA-binding domain of the transcription factor protein. Mutations in this gene, specifically a t(11,22)(q24,q12) translocation, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1 and 14.

UniProt: Q01844