Ataxin 2 Antikörper

Produktnummer ABIN4950268

Produktdetails anti-Ataxin 2 Antikörper

Target: Ataxin 2 (ATXN2)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Ataxin 2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity

Immunogen: Amino acids QSALQPIPVSTTAHFPYMTHPSVQAHHQQQL of human ATXN2 were used as the immunogen for the ATX2 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the ATX2 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL,Immunocytochemistry : 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the ATX2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu Ataxin 2

Target: Ataxin 2 (ATXN2)

Andere Bezeichnung: Ataxin-2 / ATXN2 (ATXN2 Produkte)

Synonyme: ASL13 antikoerper, ATX2 antikoerper, SCA2 antikoerper, TNRC13 antikoerper, 9630045M23Rik antikoerper, AW544490 antikoerper, Sca2 antikoerper, ATXN2 antikoerper, MGC115230 antikoerper, ataxin 2 antikoerper, ataxin 2 L homeolog antikoerper, ATXN2 antikoerper, Atxn2 antikoerper, atxn2.L antikoerper

Hintergrund: Ataxin-2, or ATX2, protein is encoded by the ATXN2 gene and contains a polyglutamine tract, long expansions (greater than 33 repeats) of which result in spinocerebellar ataxia-2 (SCA2), an autosomal dominant form of olivopontocerebellar atrophy. The gene for spinocerebellar ataxia type 2 (SCA2) has been mapped to 12q24.1. Ataxin-2 associates with L- and T-plastin and that overexpression of ataxin-2 leads to accumulation of T-plastin in mammalian cells.

UniProt: Q99700

Pathways: Ribonucleoprotein Complex Subunit Organization