Aquaporin 1 Antikörper

Produktnummer ABIN4950191

Produktdetails anti-Aquaporin 1 Antikörper

Target: Aquaporin 1 (AQP1) (Aquaporin 1 (Colton Blood Group) (AQP1))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Aquaporin 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity

Immunogen: Amino acids DRVKVWTSGQVEEYDLDADDINSRVEMKPK of human Aquaporin 1 were used as the immunogen for the Aquaporin 1 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the Aquaporin 1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the Aquaporin 1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu Aquaporin 1

Target: Aquaporin 1 (AQP1) (Aquaporin 1 (Colton Blood Group) (AQP1))

Andere Bezeichnung: AQP1 / Aquaporin 1 (AQP1 Produkte)

Synonyme: fj33g04 antikoerper, zgc:85890 antikoerper, wu:fj33g04 antikoerper, AQP1 antikoerper, CHIP28 antikoerper, AQP-CHIP antikoerper, CO antikoerper, AQP-1 antikoerper, CHIP29 antikoerper, aquaporin 1a (Colton blood group), tandem duplicate 1 antikoerper, aquaporin 1 antikoerper, aquaporin 1 (Colton blood group) antikoerper, aqp1a.1 antikoerper, AQP1 antikoerper, Aqp1 antikoerper

Hintergrund: Aquaporin 1 is a 28-kD integral protein thought at first to be a breakdown product of the Rh polypeptide but was later shown to be a unique molecule that is abundant in erythrocytes and renal tubules. AQP1 is also expressed by the choroid plexus and various other tissues. It forms a water-specific channel that provides the plasma membranes of red cells and kidney proximal tubules with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient.

UniProt: P29972

Pathways: Hormone Transport