TGFBR1 Antikörper (N-Term)
-
- Target Alle TGFBR1 Antikörper anzeigen
- TGFBR1 (Transforming Growth Factor, beta Receptor 1 (TGFBR1))
-
Bindungsspezifität
- AA 149-186, N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TGFBR1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for TGF-beta receptor type-1(TGFBR1) detection. Tested with WB in Human,Mouse,Rat.
- Sequenz
- HNRTVIHHRV PNEEDPSLDR PFISEGTTLK DLIYDMTT
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for TGF-beta receptor type-1(TGFBR1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: transforming growth factor, beta receptor 1
Protein Name: TGF-beta receptor type-1 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human TGFBR1 (149-186aa HNRTVIHHRVPNEEDPSLDRPFISEGTTLKDLIYDMTT), identical to the related mouse and rat sequences.
- Isotyp
- IgG
- Top Product
- Discover our top product TGFBR1 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
Different localization and expression of protein kinase C-beta in kidney cortex of diabetic nephropathy mice and its role in telmisartan treatment." in: American journal of translational research, Vol. 7, Issue 6, pp. 1116-25, (2015) (PubMed).
: "[Effect of interferon-α on rat liver fibrosis induced by CCl(4)]." in: Zhong nan da xue xue bao. Yi xue ban = Journal of Central South University. Medical sciences, Vol. 36, Issue 3, pp. 243-8, (2012) (PubMed).
: "The expression of AT1 receptor on hepatic stellate cells in rat fibrosis induced by CCl4." in: Chinese medical journal, Vol. 114, Issue 6, pp. 583-7, (2002) (PubMed).
: "
-
Different localization and expression of protein kinase C-beta in kidney cortex of diabetic nephropathy mice and its role in telmisartan treatment." in: American journal of translational research, Vol. 7, Issue 6, pp. 1116-25, (2015) (PubMed).
-
- Target
- TGFBR1 (Transforming Growth Factor, beta Receptor 1 (TGFBR1))
- Andere Bezeichnung
- TGFBR1 (TGFBR1 Produkte)
- Synonyme
- AAT5 antikoerper, ACVRLK4 antikoerper, ALK-5 antikoerper, ALK5 antikoerper, LDS1A antikoerper, LDS2A antikoerper, MSSE antikoerper, SKR4 antikoerper, TGFR-1 antikoerper, aat5 antikoerper, acvrlk4 antikoerper, alk-5 antikoerper, alk5 antikoerper, lds1a antikoerper, lds2a antikoerper, skr4 antikoerper, tgfr-1 antikoerper, TGFBR1 antikoerper, x-trr1 antikoerper, AU017191 antikoerper, Alk-5 antikoerper, TbetaR-I antikoerper, TbetaRI antikoerper, Alk5 antikoerper, Skr4 antikoerper, Tgfr-1 antikoerper, tbetaR-I antikoerper, tgfbr1 antikoerper, zgc:123263 antikoerper, transforming growth factor beta receptor 1 antikoerper, transforming growth factor beta receptor I antikoerper, transforming growth factor beta receptor I S homeolog antikoerper, transforming growth factor, beta receptor I antikoerper, transforming growth factor, beta receptor 1 antikoerper, transforming growth factor, beta receptor 1 a antikoerper, TGFBR1 antikoerper, tgfbr1 antikoerper, tgfbr1.S antikoerper, Tgfbr1 antikoerper, tgfbr1a antikoerper
- Hintergrund
-
Transforming growth factor, beta receptor I is a TGF beta receptor. TGFBR1 is its human gene. The protein encoded by this gene forms a heteromeric complex with type II TGF-beta receptors when bound to TGF-beta, transducing the TGF-beta signal from the cell surface to the cytoplasm. Mutations in this gene have been associated with Loeys-Dietz aortic aneurysm syndrome (LDAS). TGFB1 regulates cell cycle progression by a unique signaling mechanism that involves its binding to TGFBR2 and activation of TGFBR1. Both are transmembrane serine/threonine receptor kinases. The TGFBR1 receptor may be inactivated in many of the cases of human tumor cells refractory to TGFB-mediated cell cycle arrest.
Synonyms: AAT5 | ALK 5 | ALK5 | ALK-5 | MSSE | SKR 4 | SKR4 | TbetaR I | TbetaR-I | tgf b receptor i | TGF beta Receptor I | TGF beta receptor type 1 | TGF beta receptor type I | TGF beta type I receptor | TGF-beta receptor type I | TGF-beta receptor type-1 | TGF-beta type I receptor | TGFBR 1 | TGFBR1 protein | TGFR 1 | TGFR1 | TGFR-1 | P36897 - Gen-ID
- 7046
- UniProt
- P36897
- Pathways
- Growth Factor Binding
-