ACCN1 Antikörper (N-Term)

Produktnummer ABIN4886476

Produktdetails anti-ACCN1 Antikörper

Target: ACCN1 (Amiloride-Sensitive Cation Channel 1, Neuronal (ACCN1))

Bindungsspezifität: AA 112-147, N-Term

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACCN1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Acid-sensing ion channel 2(ASIC2) detection. Tested with WB in Human,Rat.

Sequenz: ELLALLDVNL QIPDPHLADP SVLEALRQKA NFKHYK

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Acid-sensing ion channel 2(ASIC2) detection. Tested with WB in Human,Rat.
Gene Name: acid sensing ion channel subunit 2
Protein Name: Acid-sensing ion channel 2

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ACCN1 (112-147aa ELLALLDVNLQIPDPHLADPSVLEALRQKANFKHYK), different from the related mouse and rat sequences by one amino acid.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu ACCN1

Target: ACCN1 (Amiloride-Sensitive Cation Channel 1, Neuronal (ACCN1))

Andere Bezeichnung: ASIC2 (ACCN1 Produkte)

Synonyme: ACCN antikoerper, ACCN1 antikoerper, ASIC2a antikoerper, BNC1 antikoerper, BNaC1 antikoerper, MDEG antikoerper, hBNaC1 antikoerper, ACIC2 antikoerper, Accn1 antikoerper, BNaC1a antikoerper, Mdeg antikoerper, BNC1k antikoerper, MDEG1 antikoerper, MDEG2 antikoerper, accn1 antikoerper, zASIC2 antikoerper, acid sensing ion channel subunit 2 antikoerper, acid-sensing (proton-gated) ion channel 2 antikoerper, ASIC2 antikoerper, Asic2 antikoerper, asic2 antikoerper

Hintergrund: Amiloride-sensitive cation channel 1, neuronal, also known as ASIC2, is a protein that in humans is encoded by the ACCN1 gene. This gene encodes a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, 2 hydrophobic transmembrane regions, and a large extracellular loop, which has many cysteine residues with conserved spacing. The member encoded by this gene may play a role in neurotransmission. In addition, a heteromeric association between this member and acid-sensing (proton-gated) ion channel 3 has been observed to co-assemble into proton-gated channels sensitive to gadolinium. Alternative splicing has been observed at this locus and two variants, encoding distinct isoforms, have been identified.

Synonyms: Acid sensing ion channel 2 | ACCN | ACCN1 | ASIC2 | ASIC2a | BNaC1 | BNC1 | Brain sodium channel 1 | Degenerin | MDEG | Q16515

Gen-ID: 40

UniProt: Q16515

Pathways: Sensory Perception of Sound