DAO Antikörper (N-Term)

Produktnummer ABIN4886460

Produktdetails anti-DAO Antikörper

Target: DAO (ABP1) (Amiloride Binding Protein 1 (Amine Oxidase (Copper-Containing)) (ABP1))

Bindungsspezifität: AA 144-180, N-Term

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DAO Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Amiloride-sensitive amine oxidase [copper-containing](AOC1) detection. Tested with WB in Human,Rat.

Sequenz: STAEYALLYH TLQEATKPLH QFFLNTTGFS FQDCHDR

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Amiloride-sensitive amine oxidase [copper-containing](AOC1) detection. Tested with WB in Human,Rat.
Gene Name: amine oxidase, copper containing 1
Protein Name: Amiloride-sensitive amine oxidase [copper-containing]

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ABP1 (144-180aa STAEYALLYHTLQEATKPLHQFFLNTTGFSFQDCHDR), different from the related mouse sequence by ten amino acids, and from the related rat sequence by eight amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu DAO

Target: DAO (ABP1) (Amiloride Binding Protein 1 (Amine Oxidase (Copper-Containing)) (ABP1))

Andere Bezeichnung: AOC1 (ABP1 Produkte)

Synonyme: ABP antikoerper, ABP1 antikoerper, DAO antikoerper, DAO1 antikoerper, KAO antikoerper, 1600012D06Rik antikoerper, Abp1 antikoerper, abp1 antikoerper, si:ch211-286c5.2 antikoerper, zgc:154101 antikoerper, Abp antikoerper, dao antikoerper, amine oxidase, copper containing 1 antikoerper, amine oxidase, copper-containing 1 antikoerper, AOC1 antikoerper, Aoc1 antikoerper, aoc1 antikoerper

Hintergrund: This gene encodes a metal-binding membrane glycoprotein that oxidatively deaminates putrescine, histamine, and related compounds. The encoded protein is inhibited by amiloride, a diuretic that acts by closing epithelial sodium ion channels. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. Catalyzes the degradation of compounds such as putrescine, histamine, spermine, and spermidine, substances involved in allergic and immune responses, cell proliferation, tissue differentiation, tumor formation, and possibly apoptosis. Placental DAO is thought to play a role in the regulation of the female reproductive function.

Synonyms: ABP | Abp1 | AOC1 | DAO | DAO1 | Diamine oxidase | Histaminase | KAO | Kidney amine oxidase | P19801

Gen-ID: 26

UniProt: P19801