ALDH7A1 Antikörper (C-Term)

Produktnummer ABIN4886452

Produktdetails anti-ALDH7A1 Antikörper

Target: ALDH7A1 (Aldehyde Dehydrogenase 7 Family, Member A1 (ALDH7A1))

Bindungsspezifität: AA 333-369, C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ALDH7A1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Alpha-aminoadipic semialdehyde dehydrogenase(ALDH7A1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: ARRLFIHESI HDEVVNRLKK AYAQIRVGNP WDPNVLY

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Alpha-aminoadipic semialdehyde dehydrogenase(ALDH7A1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: aldehyde dehydrogenase 7 family member A1
Protein Name: Alpha-aminoadipic semialdehyde dehydrogenase

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ALDH7A1 (333-369aa ARRLFIHESIHDEVVNRLKKAYAQIRVGNPWDPNVLY), different from the related mouse sequence by eight amino acids, and from the related rat sequence by six amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu ALDH7A1

Target: ALDH7A1 (Aldehyde Dehydrogenase 7 Family, Member A1 (ALDH7A1))

Andere Bezeichnung: ALDH7A1 (ALDH7A1 Produkte)

Synonyme: atq1 antikoerper, ALDH7A1 antikoerper, ATQ1 antikoerper, EPD antikoerper, PDE antikoerper, antiquitin antikoerper, ATQ antikoerper, wu:fi34d12 antikoerper, wu:fi35e06 antikoerper, Atq1 antikoerper, D18Wsu181e antikoerper, aldehyde dehydrogenase 7 family member A1 antikoerper, aldehyde dehydrogenase 7 family member A1 L homeolog antikoerper, aldehyde dehydrogenase 7 family, member A1 antikoerper, aldehyde dehydrogenase family 7, member A1 antikoerper, ALDH7A1 antikoerper, aldh7a1 antikoerper, aldh7a1.L antikoerper, Aldh7a1 antikoerper

Hintergrund: Aldehyde dehydrogenase 7 family, member A1, also known as ALDH7A1 or antiquitin, is an enzyme that in humans is encoded by the ALDH7A1 gene. The protein encoded by this gene is a member of subfamily 7 in the aldehyde dehydrogenase gene family. These enzymes are thought to play a major role in the detoxification of aldehydes generated by alcohol metabolism andlipid peroxidation. This particular member has homology to a previously described protein from the green garden pea, the 26g pea turgor protein. It is also involved in lysine catabolism that is known to occur in the mitochondrial matrix. Recent reports show that this protein is found both in the cytosol and the mitochondria, and the two forms likely arise from the use of alternative translation initiation sites. An additional variant encoding a different isoform has also been found for this gene. Mutations in this gene are associated with pyridoxine-dependent epilepsy. Several related pseudogenes have also been identified.

Synonyms: ALDH7A1 | Antiquitin 1 | Antiquitin | Antiquitin-1 | ATQ1 | EPD | PDE | P49419

Gen-ID: 501

UniProt: P49419

Pathways: Sensory Perception of Sound