AGO4 Antikörper (N-Term)

Produktnummer ABIN4886439

Produktdetails anti-AGO4 Antikörper

Target: AGO4 (EIF2C4) (Eukaryotic Translation Initiation Factor 2C, 4 (EIF2C4))

Bindungsspezifität: AA 114-153, N-Term

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AGO4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Protein argonaute-4(AGO4) detection. Tested with WB in Human,Rat.

Sequenz: KDQTFKVSVQ WVSVVSLQLL LEALAGHLNE VPDDSVQALD

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Protein argonaute-4(AGO4) detection. Tested with WB in Human,Rat.
Gene Name: argonaute 4, RISC catalytic component
Protein Name: Protein argonaute-4

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Argonaute 4 (114-153aa KDQTFKVSVQWVSVVSLQLLLEALAGHLNEVPDDSVQALD), identical to the related mouse sequence.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu AGO4

Target: AGO4 (EIF2C4) (Eukaryotic Translation Initiation Factor 2C, 4 (EIF2C4))

Andere Bezeichnung: AGO4 (EIF2C4 Produkte)

Synonyme: EIF2C4 antikoerper, ago4 antikoerper, Argonaute4 antikoerper, argonaute-4 antikoerper, eif2c4 antikoerper, wu:fd14f04 antikoerper, ARGONAUTE 4 antikoerper, OCP11 antikoerper, OVEREXPRESSOR OF CATIONIC PEROXIDASE 11 antikoerper, T20P8.9 antikoerper, T20P8_9 antikoerper, Eif2c4 antikoerper, 5730550L01Rik antikoerper, AI481660 antikoerper, argonaute 4, RISC catalytic component antikoerper, argonaute 1, RISC catalytic component antikoerper, argonaute RISC catalytic component 4 antikoerper, Argonaute family protein antikoerper, argonaute 4, RISC catalytic component L homeolog antikoerper, argonaute RISC catalytic subunit 4 antikoerper, AGO4 antikoerper, ago1 antikoerper, ago4 antikoerper, Ago4 antikoerper, ago4.L antikoerper

Hintergrund: AGO4 (Argonaute 4) is also known as EIF2C4. This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic containing PAZ and PIWI domains, and it may play a role in short-interfering-RNA-mediated gene silencing. This gene is located on chromosome 1 in a cluster of closely related family members including argonaute 3, and eukaryotic translation initiation factor 2C, 1.

Synonyms: Ago 4 | Ago4 | Argonaute4 |Argonaute 4 | Argonaute-4 | EIF 2C 4 | eIF-2C 4 | eIF2C 4 | eif2c4 | hAgo4 | KIAA1567 | Protein argonaute-4 | Q9HCK5

Gen-ID: 192670

Pathways: Fc-epsilon Rezeptor Signalübertragung, Regulatorische RNA Pathways, EGFR Signaling Pathway, Neurotrophin Signalübertragung, Cellular Glucan Metabolic Process