ZBTB7A Antikörper (N-Term)
-
- Target Alle ZBTB7A Antikörper anzeigen
- ZBTB7A (Zinc Finger and BTB Domain Containing 7A (ZBTB7A))
-
Bindungsspezifität
- AA 125-163, N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ZBTB7A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Zinc finger and BTB domain-containing protein 7A(ZBTB7A) detection. Tested with WB, IHC-P in Human.
- Sequenz
- DLLDRQILAA DAGADAGQLD LVDQIDQRNL LRAKEYLEF
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Zinc finger and BTB domain-containing protein 7A(ZBTB7A) detection. Tested with WB, IHC-P in Human.
Gene Name: zinc finger and BTB domain containing 7A
Protein Name: Zinc finger and BTB domain-containing protein 7A - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human ZBTB7A (125-163aa DLLDRQILAADAGADAGQLDLVDQIDQRNLLRAKEYLEF), different from the related mouse sequence by eleven amino acids, and from the related rat sequence by ten amino acids.
- Isotyp
- IgG
- Top Product
- Discover our top product ZBTB7A Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- ZBTB7A (Zinc Finger and BTB Domain Containing 7A (ZBTB7A))
- Andere Bezeichnung
- ZBTB7A (ZBTB7A Produkte)
- Synonyme
- ZBTB7A antikoerper, FBI-1 antikoerper, FBI1 antikoerper, LRF antikoerper, ZBTB7 antikoerper, ZNF857A antikoerper, pokemon antikoerper, 9030619K07Rik antikoerper, 9130006G12Rik antikoerper, AI452336 antikoerper, Lrf antikoerper, Pokemon antikoerper, Zbtb7 antikoerper, OCZF antikoerper, zinc finger and BTB domain containing 7A antikoerper, zinc finger and BTB domain containing 7C antikoerper, zinc finger and BTB domain containing 7a antikoerper, ZBTB7A antikoerper, ZBTB7C antikoerper, Zbtb7a antikoerper
- Hintergrund
-
Zinc finger and BTB domain-containing protein 7A is a protein that in humans is encoded by the ZBTB7A gene. ZBTB7A has a critical oncosuppressive role in the prostate. Prostate-specific inactivation of ZBTB7A leads to a marked acceleration of PTEN loss-driven prostate tumorigenesis through bypass of PTEN loss-induced cellular senescence. It has been showed that ZBTB7A physically interacts with SOX9 and functionally antagonizes its transcriptional activity on key target genes such as MIA, which is involved in tumor cell invasion, and H19, a long noncoding RNA precursor for an RB-targeting microRNA. Inactivation of ZBTB7A in vivo leads to RB downregulation, bypass of PTEN loss-induced cellular senescence, and invasive prostate cancer. Notably, it has been also found that ZBTB7A is genetically lost, as well as downregulated at both the mRNA and protein levels, in a subset of human advanced prostate cancers. Therefore, ZBTB7A is identified as a context-dependent cancer gene that can act as an oncogene in some contexts but that also has oncosuppressive-like activity in PTEN-null tumors.
Synonyms: DKFZp547O146 antibody|Factor binding IST protein 1 antibody|Factor that binds to inducer of short transcripts protein 1 antibody|FBI-1 antibody|FBI1 antibody|HIV-1 1st-binding protein 1 antibody|HIV-1 inducer of short transcripts binding protein antibody|HIV-1 inducer of short transcripts-binding factor 1 antibody|Leukemia/lymphoma-related factor antibody|LRF antibody|lymphoma related factor antibody|MGC99631 antibody|POK erythroid myeloid ontogenic factor antibody|Pokemon antibody|POZ and Krueppel erythroid myeloid ontogenic factor antibody|TIP21 antibody|TTF-I-interacting peptide 21 antibody|ZBT7A_HUMAN antibody|ZBTB7 antibody|ZBTB7A antibody| Zinc finger and BTB domain containing 7A antibody|zinc finger and BTB domain containing 7A, HIV-1 inducer of short transcripts binding protein antibody|Zinc finger and BTB domain-containing protein 7A antibody|Zinc finger protein 857A antibody|Zinc finger- and BTB domain-containing protein 7 antibody|ZNF857A antibody - Gen-ID
- 51341
- UniProt
- O95365
-