UPF3B Antikörper (C-Term)
-
- Target Alle UPF3B Antikörper anzeigen
- UPF3B (UPF3 Regulator of Nonsense Transcripts Homolog B (UPF3B))
-
Bindungsspezifität
- AA 416-452, C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser UPF3B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Regulator of nonsense transcripts 3B(UPF3B) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequenz
- SEKTEKKEEV VKRDRIRNKD RPAMQLYQPG ARSRNRL
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Regulator of nonsense transcripts 3B(UPF3B) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: UPF3 regulator of nonsense transcripts homolog B (yeast)
Protein Name: Regulator of nonsense transcripts 3B - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human UPF3B /RENT3B (416-452aa SEKTEKKEEVVKRDRIRNKDRPAMQLYQPGARSRNRL).
- Isotyp
- IgG
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
Antisense suppression of the nonsense mediated decay factor Upf3b as a potential treatment for diseases caused by nonsense mutations." in: Genome biology, Vol. 19, Issue 1, pp. 4, (2018) (PubMed).
: "
-
Antisense suppression of the nonsense mediated decay factor Upf3b as a potential treatment for diseases caused by nonsense mutations." in: Genome biology, Vol. 19, Issue 1, pp. 4, (2018) (PubMed).
-
- Target
- UPF3B (UPF3 Regulator of Nonsense Transcripts Homolog B (UPF3B))
- Andere Bezeichnung
- UPF3B (UPF3B Produkte)
- Synonyme
- HUPF3B antikoerper, MRXS14 antikoerper, RENT3B antikoerper, UPF3X antikoerper, 5730594O13Rik antikoerper, AI317193 antikoerper, AW541158 antikoerper, RGD1560264 antikoerper, UPF3B, regulator of nonsense mediated mRNA decay antikoerper, UPF3 regulator of nonsense transcripts homolog B (yeast) antikoerper, UPF3B antikoerper, Upf3b antikoerper
- Hintergrund
-
Regulator of nonsense transcripts 3B is a protein that in humans is encoded by the UPF3B gene. This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. The encoded protein is one of two functional homologs to yeast Upf3p. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein binds to the mRNA and remains bound after nuclear export, acting as a nucleocytoplasmic shuttling protein. It forms with Y14 a complex that binds specifically 20 nt upstream of exon-exon junctions. This gene is located on the long arm of chromosome X. Two splice variants encoding different isoforms have been found for this gene.
Synonyms: HUPF3B antibody|hUpf3p X antibody|MRXS14 antibody|Nonsense mRNA reducing factor 3B antibody|Regulator of nonsense transcripts 3B antibody|RENT3B antibody|Up-frameshift suppressor 3 homolog B antibody|Up-frameshift suppressor 3 homolog on chromosome X antibody| UPF3 regulator of nonsense transcripts homolog B (yeast) antibody|UPF3 regulator of nonsense transcripts homolog B antibody|UPF3B antibody|UPF3X antibody - Gen-ID
- 65109
-