RENT1/UPF1 Antikörper (Middle Region)
-
- Target Alle RENT1/UPF1 (UPF1) Antikörper anzeigen
- RENT1/UPF1 (UPF1) (UPF1 Regulator of Nonsense Transcripts Homolog (UPF1))
-
Bindungsspezifität
- AA 578-614, Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RENT1/UPF1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Regulator of nonsense transcripts 1(UPF1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequenz
- NMDSMPELQK LQQLKDETGE LSSADEKRYR ALKRT
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Regulator of nonsense transcripts 1(UPF1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: UPF1 regulator of nonsense transcripts homolog (yeast)
Protein Name: Regulator of nonsense transcripts 1 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human RENT1/hUPF1 (578-614aa NMDSMPELQKLQQLKDETGELSSADEKRYRALKRT AE), identical to the related mouse and rat sequences.
- Isotyp
- IgG
- Top Product
- Discover our top product UPF1 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- RENT1/UPF1 (UPF1) (UPF1 Regulator of Nonsense Transcripts Homolog (UPF1))
- Andere Bezeichnung
- UPF1 (UPF1 Produkte)
- Synonyme
- HUPF1 antikoerper, NORF1 antikoerper, RENT1 antikoerper, pNORF1 antikoerper, smg-2 antikoerper, B430202H16Rik antikoerper, PNORF-1 antikoerper, Rent1 antikoerper, Upflp antikoerper, rent1 antikoerper, wu:fi40f07 antikoerper, wu:fj48a01 antikoerper, zgc:55472 antikoerper, Tb05.3C6.50 antikoerper, AO090012000584 antikoerper, hupf1 antikoerper, norf1 antikoerper, pnorf1 antikoerper, upf1 antikoerper, UPF1, RNA helicase and ATPase antikoerper, UPF1 regulator of nonsense transcripts homolog (yeast) antikoerper, upf1 regulator of nonsense transcripts homolog (yeast) antikoerper, regulator of nonsense transcripts 1 antikoerper, Regulator of nonsense transcripts 1 antikoerper, UPF1 regulator of nonsense transcripts homolog S homeolog antikoerper, UPF1 antikoerper, Upf1 antikoerper, upf1 antikoerper, Tc00.1047053511317.30 antikoerper, Tb927.5.2140 antikoerper, TVAG_453890 antikoerper, TVAG_237840 antikoerper, AOR_1_1018194 antikoerper, HPB8_739 antikoerper, smg-2 antikoerper, upf1.S antikoerper
- Hintergrund
-
Regulator of nonsense transcripts 1 is a protein that in humans is encoded by the UPF1 gene. This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. And this protein is located only in the cytoplasm. When translation ends, it interacts with the protein that is a functional homolog of yeast Upf2p to trigger mRNA decapping. Use of multiple polyadenylation sites has been noted for this gene. Alternative splicing results in multiple transcript variants.
Synonyms: ATP dependent helicase RENT1 antibody|ATP-dependent helicase RENT1 antibody|Delta helicase antibody|FLJ43809 antibody|FLJ46894 antibody|HUPF 1 antibody|hUpf1 antibody|KIAA0221 antibody|Nonsense mRNA reducing factor 1 antibody|NORF 1 antibody|NORF1 antibody| pNORF 1 antibody|pNORF1 antibody|Regulator of nonsense transcripts 1 antibody|RENT 1 antibody|RENT1 antibody|RENT1_HUMAN antibody|Smg 2 antibody|Smg 2 homolog nonsense mediated mRNA decay factor antibody|UP Frameshift 1 antibody|Up frameshift mutation 1 homolog (S. cerevisiae) antibody|Up frameshift mutation 1 homolog antibody|Up frameshift suppressor 1 homolog antibody|Up-frameshift suppressor 1 homolog antibody|UPF 1 antibody|UPF 1 regulator of nonsense transcripts homolog antibody|upf1 antibody|UPF1 regulator of nonsense transcripts homolog antibody|Yeast Upf1p homolog antibody - Gen-ID
- 5976
- UniProt
- Q92900
- Pathways
- SARS-CoV-2 Protein Interaktom
-