PDIA3 Antikörper (C-Term)
-
- Target Alle PDIA3 Antikörper anzeigen
- PDIA3 (Protein Disulfide Isomerase Family A, Member 3 (PDIA3))
-
Bindungsspezifität
- AA 471-505, C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PDIA3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Protein disulfide-isomerase A3(PDIA3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequenz
- RELSDFISYL QREATNPPVI QEEKPKKKKK AQEDL
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Protein disulfide-isomerase A3(PDIA3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: protein disulfide isomerase family A, member 3
Protein Name: Protein disulfide-isomerase A3 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human ERp57 (471-505aa RELSDFISYLQREATNPPVIQEEKPKKKKKAQEDL), different from the related mouse and rat sequences by two amino acids.
- Isotyp
- IgG
- Top Product
- Discover our top product PDIA3 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
Redox proteomics identification of specifically carbonylated proteins in the hippocampi of triple transgenic Alzheimer's disease mice at its earliest pathological stage." in: Journal of proteomics, Vol. 123, pp. 101-13, (2015) (PubMed).
: "
-
Redox proteomics identification of specifically carbonylated proteins in the hippocampi of triple transgenic Alzheimer's disease mice at its earliest pathological stage." in: Journal of proteomics, Vol. 123, pp. 101-13, (2015) (PubMed).
-
- Target
- PDIA3 (Protein Disulfide Isomerase Family A, Member 3 (PDIA3))
- Andere Bezeichnung
- PDIA3 (PDIA3 Produkte)
- Synonyme
- ER60 antikoerper, ERp57 antikoerper, ERp60 antikoerper, ERp61 antikoerper, GRP57 antikoerper, GRP58 antikoerper, HsT17083 antikoerper, P58 antikoerper, PI-PLC antikoerper, grp-58 antikoerper, 58kDa antikoerper, Erp antikoerper, Grp58 antikoerper, PDI antikoerper, PDI-Q2 antikoerper, PLC[a] antikoerper, Plca antikoerper, 1 antikoerper, 25D3-membrane-associated antikoerper, sb:cb825 antikoerper, erp57 antikoerper, grp58 antikoerper, pdia3 antikoerper, protein disulfide isomerase family A member 3 antikoerper, protein disulfide-isomerase A3 antikoerper, protein disulfide isomerase associated 3 antikoerper, protein disulfide isomerase family A, member 3 antikoerper, protein disulfide isomerase family A member 3 S homeolog antikoerper, PDIA3 antikoerper, Tsp_10062 antikoerper, Pdia3 antikoerper, pdia3 antikoerper, pdia3.S antikoerper
- Hintergrund
-
PDIA3 (Protein disulfide isomerase family A, member 3), also called GRP58, Erp57 or ER60, is an isomerase enzyme. It is mapped on 15q15.3. PDIA3 is also part of the major histocompatibility complex (MHC) class I peptide-loading complex, which is essential for formation of the final antigen conformation and export from the endoplasmic reticulum to the cell surface. This gene encodes a protein of the endoplasmic reticulum that interacts with lectin chaperones calreticulin and calnexin to modulate folding of newly synthesized glycoproteins. The protein was once thought to be a phospholipase, however, it has been demonstrated that the protein actually has protein disulfide isomerase activity. It is thought that complexes of lectins and this protein mediate protein folding by promoting formation of disulfide bonds in their glycoprotein substrates.
Synonyms: 58 kDa glucose regulated protein antibody|58 kDa glucose-regulated protein antibody|58 kDa microsomal protein antibody|Disulfide isomerase ER 60 antibody|Disulfide isomerase ER-60 antibody|Endoplasmic reticulum resident protein 57 antibody|Endoplasmic reticulum resident protein 60 antibody|ER p57 antibody|ER protein 57 antibody|ER protein 60 antibody|ERp 57 antibody|ERp57 antibody|ERp60 antibody|ERp61 antibody|Glucose Regulated Protein 58 Kd antibody|GRP 57 antibody|GRP 58 antibody|GRP57 antibody|GRP58 antibody| HsT17083 antibody|P58 antibody|PDIA 3 antibody|PDIA3 antibody|PDIA3_HUMAN antibody|Phospholipase C alpha antibody|PI PLC antibody| Protein disulfide isomerase A3 antibody|Protein disulfide isomerase family A member 3 antibody|Protein disulfide-isomerase A3 antibody - Gen-ID
- 2923
- UniProt
- P30101
- Pathways
- Maintenance of Protein Location, Protein targeting to Nucleus, Cell RedoxHomeostasis
-