PCSK6 Antikörper (C-Term)

Produktnummer ABIN3043593

Produktdetails anti-PCSK6 Antikörper

Target: PCSK6 (Proprotein Convertase Subtilisin/kexin Type 6 (PCSK6))

Bindungsspezifität: AA 614-651, C-Term

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PCSK6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Proprotein convertase subtilisin/kexin type 6(PCSK6) detection. Tested with WB in Human,Rat.

Sequenz: RNPEKQGKLK EWSLILYGTA EHPYHTFSAH QSRSRMLE

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Proprotein convertase subtilisin/kexin type 6(PCSK6) detection. Tested with WB in Human,Rat.
Gene Name: proprotein convertase subtilisin/kexin type 6
Protein Name: Proprotein convertase subtilisin/kexin type 6

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human PACE4 (614-651aa RNPEKQGKLKEWSLILYGTAEHPYHTFSAHQSRSRMLE), different from the related rat sequence by two amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu PCSK6

Target: PCSK6 (Proprotein Convertase Subtilisin/kexin Type 6 (PCSK6))

Andere Bezeichnung: PCSK6 (PCSK6 Produkte)

Synonyme: PACE4 antikoerper, PCSK6 antikoerper, SPC4 antikoerper, C86343 antikoerper, Pace4 antikoerper, Spc4 antikoerper, PACE4AIIa antikoerper, Xpace4 antikoerper, spc4 antikoerper, proprotein convertase subtilisin/kexin type 6 antikoerper, peptidase S8 antikoerper, proprotein convertase subtilisin/kexin type 6 L homeolog antikoerper, PCSK6 antikoerper, EAMY_RS27925 antikoerper, pcsk6 antikoerper, Pcsk6 antikoerper, pcsk6.L antikoerper

Hintergrund: Proprotein convertase subtilisin/kexin type 6 is an enzyme that in humans is encoded by the PCSK6 gene. This gene encodes a member of the subtilisin-like proprotein convertase family, which includes proteases that process protein and peptide precursors trafficking through regulated or constitutive branches of the secretory pathway. The encoded protein undergoes an initial autocatalytic processing event in the ER to generate a heterodimer which exits the ER and sorts to the trans-Golgi network where a second autocatalytic event takes place and the catalytic activity is acquired. The encoded protease is constitutively secreted into the extracellular matrix and expressed in many tissues, including neuroendocrine, liver, gut, and brain. This gene encodes one of the seven basic amino acid-specific members which cleave their substrates at single or paired basic residues. Some of its substrates include transforming growth factor beta related proteins, proalbumin, and von Willebrand factor. This gene is thought to play a role in tumor progression and left-right patterning. Alternatively spliced transcript variants encoding different isoforms have been identified.

Synonyms: Paired basic amino acid cleaving enzyme 4 antibody|Paired basic amino acid cleaving system 4 antibody|PCSK6 antibody|PCSK6_HUMAN antibody|Proprotein convertase subtilisin/kexin type 6 antibody|SPC4 antibody|Subtilisin like protease antibody|Subtilisin-like proprotein convertase 4 antibody|subtilisin/kexin like protease PACE4 antibody|Subtilisin/kexin-like protease PACE4 antibody

Gen-ID: 5046

UniProt: P29122

Pathways: Neurotrophin Signalübertragung, SARS-CoV-2 Protein Interaktom