NQO1 Antikörper (C-Term)
-
- Target Alle NQO1 Antikörper anzeigen
- NQO1 (NAD(P)H Dehydrogenase, Quinone 1 (NQO1))
-
Bindungsspezifität
- AA 242-274, C-Term
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NQO1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for NAD(P)H dehydrogenase [quinone] 1(NQO1) detection. Tested with WB in Human,Rat.
- Sequenz
- EVQDEEKNKK FGLSVGHHLG KSIPTDNQIK ARK
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for NAD(P)H dehydrogenase [quinone] 1(NQO1) detection. Tested with WB in Human,Rat.
Gene Name: NAD(P)H dehydrogenase, quinone 1
Protein Name: NAD(P)H dehydrogenase [quinone] 1 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human NQO1 (242-274aa EVQDEEKNKKFGLSVGHHLGKSIPTDNQIKARK), different from the related mouse and rat sequences by five amino acids.
- Isotyp
- IgG
- Top Product
- Discover our top product NQO1 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- NQO1 (NAD(P)H Dehydrogenase, Quinone 1 (NQO1))
- Andere Bezeichnung
- NQO1 (NQO1 Produkte)
- Synonyme
- zgc:77191 antikoerper, wu:fb63c10 antikoerper, nqo1 antikoerper, DHQU antikoerper, DIA4 antikoerper, DTD antikoerper, NMOR1 antikoerper, NMORI antikoerper, QR1 antikoerper, Dia4 antikoerper, AV001255 antikoerper, Dtd antikoerper, Nmo-1 antikoerper, Nmo1 antikoerper, Nmor1 antikoerper, Ox-1 antikoerper, Ox1 antikoerper, Qr1 antikoerper, NADPH-d antikoerper, NAD(P)H dehydrogenase, quinone 1 antikoerper, NAD(P)H quinone dehydrogenase 1 antikoerper, NAD(P)H dehydrogenase, quinone 1 L homeolog antikoerper, nqo1 antikoerper, NQO1 antikoerper, Bpet2092 antikoerper, nqo1.L antikoerper, Nqo1 antikoerper
- Hintergrund
-
This gene is a member of the NAD(P)H dehydrogenase (quinone) family and encodes a cytoplasmic 2-electron reductase. And this FAD-binding protein forms homodimers and reduces quinones to hydroquinones. In addition, this protein's enzymatic activity prevents the one electron reduction of quinones that results in the production of radical species. Mutations in this gene have been associated with tardive dyskinesia (TD), an increased risk of hematotoxicity after exposure to benzene, and susceptibility to various forms of cancer. Altered expression of this protein has been seen in many tumors and is also associated with Alzheimer's disease (AD). Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Synonyms: Azoreductase antibody|Cytochrome b 5 reductase antibody|DHQU antibody|DIA 4 antibody|DIA4 antibody|Diaphorase (NADH/NADPH) (cytochrome b 5 reductase) antibody|Diaphorase (NADH/NADPH) antibody|Diaphorase 4 antibody|Dioxin inducible 1 antibody|DT diaphorase antibody|DT-diaphorase antibody|DTD antibody|Menadione reductase antibody|NAD(P)H dehydrogenase [quinone] 1 antibody|NAD(P)H dehydrogenase quinone 1 antibody|NAD(P)H menadione oxidoreductase 1 dioxin inducible antibody|NAD(P)H: menadione oxidoreductase 1 dioxin inducible 1 antibody|NAD(P)H:menadione oxidoreductase 1 antibody|NAD(P)H:Quinone acceptor oxidoreductase type 1 antibody|NAD(P)H:quinone oxidoreductase 1 antibody| NAD(P)H:quinone oxireductase antibody|NMOR 1 antibody|NMOR I antibody|NMOR1 antibody|NMORI antibody|NQO 1 antibody|NQO1 antibody|NQO1_HUMAN antibody|Phylloquinone reductase antibody| QR 1 antibody|QR1 antibody|Quinone reductase 1 antibody - Gen-ID
- 1728
- UniProt
- P15559
-