RAB11A Antikörper (C-Term)

Produktnummer ABIN3043558

Produktdetails anti-RAB11A Antikörper

Target: RAB11A (RAB11A, Member RAS Oncogene Family (RAB11A))

Bindungsspezifität: AA 171-211, C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RAB11A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Ras-related protein Rab-11A(RAB11A) detection. Tested with WB in Human.

Sequenz: EIYRIVSQKQ MSDRRENDMS PSNNVVPIHV PPTTENKPKV Q

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Ras-related protein Rab-11A(RAB11A) detection. Tested with WB in Human.
Gene Name: RAB11A, member RAS oncogene family
Protein Name: Ras-related protein Rab-11A

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Rab11A (171-211aa EIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQ), identical to the related mouse and rat sequences.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu RAB11A

Target: RAB11A (RAB11A, Member RAS Oncogene Family (RAB11A))

Andere Bezeichnung: RAB11A (RAB11A Produkte)

Synonyme: rab11 antikoerper, RAB11A antikoerper, wu:fi15h09 antikoerper, zgc:103679 antikoerper, yl8 antikoerper, Rab11a antikoerper, rab11A antikoerper, DDBDRAFT_0190819 antikoerper, DDBDRAFT_0191190 antikoerper, DDB_0190819 antikoerper, DDB_0191190 antikoerper, YL8 antikoerper, RAB11 antikoerper, RAB11A, member RAS oncogene family S homeolog antikoerper, RAB11A, member RAS oncogene family antikoerper, RAB11a, member RAS oncogene family antikoerper, Rab11 GTPase antikoerper, rab11A protein antikoerper, Rab11a, GTPase antikoerper, Rab GTPase antikoerper, rab11A, RAB family GTPase antikoerper, rab11a.S antikoerper, RAB11A antikoerper, rab11a antikoerper, Rab11a antikoerper, rab11A antikoerper

Hintergrund: Ras-related protein Rab-11A is a protein that in humans is encoded by the RAB11A gene. The protein encoded by this gene belongs to the small GTPase superfamily, Rab family which plays essential roles in vesicle and granule targeting. It is mapped to 15q22.31. RAB11A is associated with both constitutive and regulated secretory pathways, and may be involved in protein transport. Additionally, RAB11A can control intracellular trafficking of the innate immune receptor TLR4, and thereby also receptor signaling. It has been shown to interact with RAB11FIP2, RAB11FIP4, and RAB11FIP1 and so on.

Synonyms: MGC1490 antibody|Rab 11 antibody|Rab 11A antibody|RAB 11A member oncogene family antibody|RAB 11A, member oncogene family antibody| Rab-11 antibody|RAB11 A antibody|RAB11 antibody|RAB11A antibody|RAB11A member RAS oncogene family antibody|Ras related protein Rab 11A antibody|Ras related protein Rab11A antibody|Ras-related protein Rab-11A antibody|YL 8 antibody|YL8 antibody

Gen-ID: 8766

UniProt: P62491

Pathways: Regulation of Cell Size, Thromboxane A2 Receptor Signaling, Regulation of long-term Neuronal Synaptic Plasticity