RAB14 Antikörper (C-Term)

Produktnummer ABIN3043364

Produktdetails anti-RAB14 Antikörper

Target: RAB14 (RAB14, Member RAS Oncogene Family (RAB14))

Bindungsspezifität: AA 124-153, C-Term

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RAB14 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Ras-related protein Rab-14(RAB14) detection. Tested with WB in Human,Rat.

Sequenz: NKADLEAQRD VTYEEAKQFA EENGLLFLEA

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Ras-related protein Rab-14(RAB14) detection. Tested with WB in Human,Rat.
Gene Name: RAB14, member RAS oncogene family
Protein Name: Ras-related protein Rab-14

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human RAB14 (124-153aa NKADLEAQRDVTYEEAKQFAEENGLLFLEA), identical to the related mouse and rat sequences.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu RAB14

Target: RAB14 (RAB14, Member RAS Oncogene Family (RAB14))

Andere Bezeichnung: RAB14 (RAB14 Produkte)

Synonyme: FBP antikoerper, RAB-14 antikoerper, 0610030G24Rik antikoerper, 2810475J17Rik antikoerper, A830021G03Rik antikoerper, AI314285 antikoerper, AI649155 antikoerper, D030017L14Rik antikoerper, cb731 antikoerper, fc26g11 antikoerper, fj47f07 antikoerper, fj68a01 antikoerper, wu:fc26g11 antikoerper, wu:fj47f07 antikoerper, wu:fj68a01 antikoerper, fbp antikoerper, rab-14 antikoerper, MGC79630 antikoerper, MGC80680 antikoerper, RAB14 antikoerper, RAB14, member RAS oncogene family antikoerper, RAB14, member RAS oncogene family S homeolog antikoerper, RAB14 antikoerper, Rab14 antikoerper, rab14 antikoerper, rab14.S antikoerper

Hintergrund: Ras-related protein Rab-14 is a protein that in humans is encoded by the RAB14 gene. It is mapped to 9q33.2 based on an alignment of the RAB14 sequence with the genomic sequence. RAB14 belongs to the large RAB family of low molecular mass GTPases that are involved in intracellular membrane trafficking. These proteins act as molecular switches that flip between an inactive GDP-bound state and an active GTP-bound state in which they recruit downstream effector proteins onto membranes.

Synonyms: bA165P4.3 antibody|F protein binding protein 1 antibody|FBP antibody|GTPase Rab14 antibody|RAB 14 antibody|RAB14 antibody|RAB14 member RAS oncogene family antibody|RAB14_HUMAN antibody|Ras related protein Rab 14 antibody|Ras-related protein Rab-14 antibody|RP11 165P4.4 antibody|Small GTP binding protein RAB14 antibody

Gen-ID: 51552

UniProt: P61106

Pathways: Asymmetric Protein Localization, SARS-CoV-2 Protein Interaktom