KERA Antikörper (C-Term)

Produktnummer ABIN3043276

Produktdetails anti-KERA Antikörper

Target: KERA (Keratocan (KERA))

Bindungsspezifität: AA 77-109, C-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KERA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Keratocan(KERA) detection. Tested with WB in Human,Mouse.

Sequenz: YLQNNLIETI PEKPFENATQ LRWINLNKNK ITN

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Keratocan(KERA) detection. Tested with WB in Human,Mouse.
Gene Name: keratocan
Protein Name: Keratocan

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Keratocan (77-109aa YLQNNLIETIPEKPFENATQLRWINLNKNKITN), different from the related mouse sequence by two amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu KERA

Target: KERA (Keratocan (KERA))

Andere Bezeichnung: KERA (KERA Produkte)

Synonyme: KERA antikoerper, si:dkeyp-38g8.3 antikoerper, zgc:136259 antikoerper, CNA2 antikoerper, SLRR2B antikoerper, keratocan antikoerper, KERA antikoerper, kera antikoerper, Kera antikoerper

Hintergrund: Keratocan (KTN), also known as keratan sulfate proteoglycan keratocan, is a protein that in humans is encoded by the KERA gene. It is mapped to 12q22. The protein encoded by this gene is a keratan sulfate proteoglycan that is involved in corneal transparency. Defects in this gene are a cause of autosomal recessive cornea plana 2 (CNA2). Keratan sulfate proteoglycans (KSPGs) are members of the small leucine-rich proteoglycan (SLRP) family. KSPGs, particularly keratocan, lumican and mimecan, are important to the transparency of the cornea.

Synonyms: CNA2 antibody|KERA antibody|KERA_HUMAN antibody|Keratan sulfate proteoglycan keratocan antibody|Keratocan antibody|KTN antibody|SLRR2B antibody

Gen-ID: 11081

UniProt: O60938

Pathways: Glycosaminoglycan Metabolic Process