ETV4 Antikörper (N-Term)

Produktnummer ABIN3042379

Produktdetails anti-ETV4 Antikörper

Target: ETV4 (Ets Variant 4 (ETV4))

Bindungsspezifität: AA 1-41, N-Term

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ETV4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for ETS translocation variant 4(ETV4) detection. Tested with WB in Human,Rat.

Sequenz: MERRMKAGYL DQQVPYTFSS KSPGNGSLRE ALIGPLGKLM D

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for ETS translocation variant 4(ETV4) detection. Tested with WB in Human,Rat.
Gene Name: ets variant 4
Protein Name: ETS translocation variant 4

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Pea3 (1-41aa MERRMKAGYLDQQVPYTFSSKSPGNGSLREALIGPLGKLMD), different from the related mouse sequence by seven amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu ETV4

Target: ETV4 (Ets Variant 4 (ETV4))

Andere Bezeichnung: ETV4 (ETV4 Produkte)

Synonyme: E1A-F antikoerper, E1AF antikoerper, PEA3 antikoerper, PEAS3 antikoerper, Pea3 antikoerper, AW414408 antikoerper, Pea-3 antikoerper, pea3 antikoerper, ETS variant 4 antikoerper, ets variant 4 antikoerper, ETV4 antikoerper, Etv4 antikoerper, etv4 antikoerper

Hintergrund: ETS translocation variant 4 (ETV4), also known as polyoma enhancer activator 3 (PEA3), or E1AF, is a member of the PEA3 subfamily of Ets transcription factors. It is mapped to 17q21.31. E1AF can activate the promoters of various matrix metalloproteinases, genes whose expression is associated with tumor cell invasion and metastasis, by 10 to 20 fold. Pea3 is detected in cells of epithelial and fibroblastic origin. It is also a transcriptional activator that binds to the enhancer of the adenovirus E1A gene.

Synonyms: Adenovirus E1A enhancer binding protein antibody|Adenovirus E1A enhancer-binding protein antibody|E1A F antibody|E1A-F antibody|ETS translocation variant 4 antibody|ets variant gene 4 (E1A enhancer binding protein E1AF) antibody|ETV4 antibody|ETV4_HUMAN antibody| PEA3 antibody|PEA3 protein antibody|PEAS3 antibody|Polyomavirus enhancer activator 3 antibody|Polyomavirus enhancer activator 3 homolog antibody|Protein PEA3 antibody

Gen-ID: 2118

UniProt: P43268