OTX2 Antikörper (C-Term)

Produktnummer ABIN3032102

Produktdetails anti-OTX2 Antikörper

Target: OTX2 (Orthodenticle Homeobox 2 (OTX2))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser OTX2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Antigen affinity

Immunogen: An amino acid sequence from the C-terminus of human Orthodenticle homeobox 2 (DYKDQTASWKLNFNADCLDYKDQTSSWKFQVL) was used as the immunogen for this Otx2 antibody (100% mouse homology).

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: The stated application concentrations are suggested starting amounts. Titration of the Otx2 antibody may be required due to differences in protocols and secondary/substrate sensitivity.\. Western blot: 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the Otx2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu OTX2

Target: OTX2 (Orthodenticle Homeobox 2 (OTX2))

Andere Bezeichnung: Otx2 (OTX2 Produkte)

Synonyme: CPHD6 antikoerper, MCOPS5 antikoerper, E130306E05Rik antikoerper, id:ibd2915 antikoerper, zOtx2 antikoerper, zgc:136535 antikoerper, zotx-2 antikoerper, Xotx-2 antikoerper, Xotx2 antikoerper, otx-2 antikoerper, otx2 antikoerper, orthodenticle homeobox 2 antikoerper, orthodenticle homeobox 2 S homeolog antikoerper, orthodenticle homeobox 2 L homeolog antikoerper, OTX2 antikoerper, Otx2 antikoerper, otx2 antikoerper, otx2.S antikoerper, otx2.L antikoerper

Hintergrund: Orthodenticle homeobox 2 is also known as CPHD6 or MCOPS5. The OTX2 gene encodes a member of the bicoid subfamily of homeodomain-containing transcription factors. Otx2 acts as a transcription factor and plays a role in brain, craniofacial, and sensory organ development. The encoded protein also influences the proliferation and differentiation of dopaminergic neuronal progenitor cells during mitosis. Mutations in this gene cause syndromic microphthalmia 5 (MCOPS5) and combined pituitary hormone deficiency 6 (CPHD6). Otx2 is also suspected of having an oncogenic role in medulloblastoma. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Pseudogenes of this gene are known to exist on chromosomes two and nine.

Gen-ID: 5015

Pathways: Dopaminergic Neurogenesis