SLC22A2 Antikörper (AA 524-555)

Produktnummer ABIN2744389

Produktdetails anti-SLC22A2 Antikörper

Target: SLC22A2 (Solute Carrier Family 22 (Organic Cation Transporter), Member 2 (SLC22A2))

Bindungsspezifität: AA 524-555

Reaktivität: Human, Ratte, Maus, Affe, Orang-Utan

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC22A2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Spezifität: Mainly expressed in kidney. Localized at the luminal membrane and basolateral membrane of kidney distal tubule and proximal tubules. To a lower extent, expressed in neurons of the cerebral cortex and in various subcortical nuclei (at protein levels). Also detected in secretory phase endometrium, in scattered cells in the stroma. .

Aufreinigung: Immunogen affinity purified

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human SLC22A2 (524-555aa ETIEEAENMQRPRKNKEKMIYLQVQKLDIPLN), different from the related mouse sequence by five amino acids, and from the related rat sequence by seven amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal working dilution should be determined by the investigator.

Kommentare:

Target Species of Antibody: Human

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Distilled water

Konzentration: Lot specific

Buffer: Lyophilized from 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg sodium phosphate, 0.05 mg sodium azide

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: avoid freeze thaw cycles

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.

Details zu SLC22A2

Target: SLC22A2 (Solute Carrier Family 22 (Organic Cation Transporter), Member 2 (SLC22A2))

Andere Bezeichnung: SLC22A2 (SLC22A2 Produkte)

Synonyme: OCT2 antikoerper, Oct2 antikoerper, Orct2 antikoerper, OCT2r antikoerper, rOCT2 antikoerper, Pou2f2 antikoerper, OCT2P antikoerper, oct1 antikoerper, wu:fc01b11 antikoerper, zgc:64076 antikoerper, slc22a2 antikoerper, solute carrier family 22 member 2 antikoerper, solute carrier family 22 (organic cation transporter), member 2 antikoerper, POU class 2 homeobox 2 antikoerper, solute carrier family 22 (organic cation transporter), member 2 L homeolog antikoerper, SLC22A2 antikoerper, Slc22a2 antikoerper, POU2F2 antikoerper, LOC521027 antikoerper, slc22a2 antikoerper, slc22a2.L antikoerper

Hintergrund: Name/Gene ID: SLC22A2
Subfamily: Organic cation transporter
Family: Transporter

Synonyms: SLC22A2, HOCT2, OCT2, Organic cation transporter 2

Gen-ID: 6582