SLC22A2 Antikörper (AA 524-555)
-
- Target Alle SLC22A2 Antikörper anzeigen
- SLC22A2 (Solute Carrier Family 22 (Organic Cation Transporter), Member 2 (SLC22A2))
-
Bindungsspezifität
- AA 524-555
-
Reaktivität
- Human, Ratte, Maus, Affe, Orang-Utan
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC22A2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Spezifität
- Mainly expressed in kidney. Localized at the luminal membrane and basolateral membrane of kidney distal tubule and proximal tubules. To a lower extent, expressed in neurons of the cerebral cortex and in various subcortical nuclei (at protein levels). Also detected in secretory phase endometrium, in scattered cells in the stroma. .
- Aufreinigung
- Immunogen affinity purified
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human SLC22A2 (524-555aa ETIEEAENMQRPRKNKEKMIYLQVQKLDIPLN), different from the related mouse sequence by five amino acids, and from the related rat sequence by seven amino acids.
- Isotyp
- IgG
- Top Product
- Discover our top product SLC22A2 Primärantikörper
-
-
- Applikationshinweise
- Optimal working dilution should be determined by the investigator.
- Kommentare
-
Target Species of Antibody: Human
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Distilled water
- Konzentration
- Lot specific
- Buffer
- Lyophilized from 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg sodium phosphate, 0.05 mg sodium azide
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- avoid freeze thaw cycles
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.
-
- Target
- SLC22A2 (Solute Carrier Family 22 (Organic Cation Transporter), Member 2 (SLC22A2))
- Andere Bezeichnung
- SLC22A2 (SLC22A2 Produkte)
- Synonyme
- OCT2 antikoerper, Oct2 antikoerper, Orct2 antikoerper, OCT2r antikoerper, rOCT2 antikoerper, Pou2f2 antikoerper, OCT2P antikoerper, oct1 antikoerper, wu:fc01b11 antikoerper, zgc:64076 antikoerper, slc22a2 antikoerper, solute carrier family 22 member 2 antikoerper, solute carrier family 22 (organic cation transporter), member 2 antikoerper, POU class 2 homeobox 2 antikoerper, solute carrier family 22 (organic cation transporter), member 2 L homeolog antikoerper, SLC22A2 antikoerper, Slc22a2 antikoerper, POU2F2 antikoerper, LOC521027 antikoerper, slc22a2 antikoerper, slc22a2.L antikoerper
- Hintergrund
-
Name/Gene ID: SLC22A2
Subfamily: Organic cation transporter
Family: Transporter
Synonyms: SLC22A2, HOCT2, OCT2, Organic cation transporter 2 - Gen-ID
- 6582
-