PTGER4 Antikörper

Produktnummer ABIN2451693

Produktdetails anti-PTGER4 Antikörper

Target: PTGER4 (Prostaglandin E Receptor 4 (Subtype EP4) (PTGER4))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PTGER4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunocytochemistry (ICC)

Spezifität: Does not cross-react with EP1, EP3, or EP4 receptors. The EP2 receptor appears to be expressed at low levels in many tissues and cell types, potentially making detection by immunochemical techniques difficult.

Kreuzreaktivität: Maus, Ratte (Rattus), Schaf

Homologie: Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Monkey (100%) Gibbon, Bovine (97%) Rabbit (93%) Marmoset (90%) Bat, Hamster, Elephant, Panda (87%) Horse (83%) Mouse, Rat (80%).

Aufreinigung: Affinity Purified

Immunogen: Human EP4 receptor C-terminal amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI).

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: ICC, IHC-P (5 µg/mL), WB (1:200)

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Konzentration: Lot specific

Buffer: TBS, pH 7.4, 0.02% sodium azide, 0.5 mg/mL BSA, 50% glycerol.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: avoid freeze thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Short term 4°C, long term aliquot and store at -20°C, avoid freeze thaw cycles.

Details zu PTGER4

Target: PTGER4 (Prostaglandin E Receptor 4 (Subtype EP4) (PTGER4))

Andere Bezeichnung: PTGER4 / EP4 (PTGER4 Produkte)

Synonyme: EP4 antikoerper, PGE2R-EP4 antikoerper, ptger4 antikoerper, ptger4l antikoerper, PTGER4 antikoerper, EP4R antikoerper, Ptgerep4 antikoerper, Ptger antikoerper, ep4 antikoerper, prostaglandin E receptor 4 antikoerper, prostaglandin E receptor 4 (subtype EP4) antikoerper, prostaglandin E receptor 4 (subtype EP4) a antikoerper, prostaglandin E receptor 4 subtype EP4 antikoerper, PTGER4 antikoerper, ptger4a antikoerper, ptger4 antikoerper, Ptger4 antikoerper

Hintergrund: Standard Gene Symbol: PTGER4, Gene Family: GPCR, Gene Subfamily: Prostanoid, Synonyms: PTGER4, EP4, EP4 prostaglandin receptor, EP4R, PGE receptor EP4 subtype, Prostanoid EP4 receptor, Prostaglandin E receptor 4, PGE receptor, EP4 subtype, PGE2 receptor EP4 subtype

Gen-ID: 5734

UniProt: P35408