Ataxin 1 Antikörper (AA 164-197) (FITC)
-
- Target Alle Ataxin 1 (ATXN1) Antikörper anzeigen
- Ataxin 1 (ATXN1)
-
Bindungsspezifität
- AA 164-197
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Maus
-
Klonalität
- Monoklonal
-
Konjugat
- Dieser Ataxin 1 Antikörper ist konjugiert mit FITC
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC), Immunoprecipitation (IP)
- Spezifität
- Detects a 85 kD protein.
- Aufreinigung
- Protein G purified from tissue culture supernatant
- Immunogen
-
Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1 (Accession No. P54254). Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). Percent identity by BLAST analysis: Mouse, Rat (100%).
Type of Immunogen: Synthetic peptide - Klon
- S76-8
- Isotyp
- IgG2b
- Top Product
- Discover our top product ATXN1 Primärantikörper
-
-
- Applikationshinweise
-
Approved: IHC, IP, WB
Usage: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested. - Kommentare
-
Target Species of Antibody: Human
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Liquid
- Konzentration
- Lot specific
- Buffer
- PBS, pH 7.4, 0.1 % sodium azide, 50 % glycerol.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- -20 °C
- Informationen zur Lagerung
- Store at -20°C.
-
- Target
- Ataxin 1 (ATXN1)
- Andere Bezeichnung
- ATXN1 / Ataxin-1 / SCA1 (ATXN1 Produkte)
- Synonyme
- ATX1 antikoerper, D6S504E antikoerper, SCA1 antikoerper, ATXN1 antikoerper, ataxin 1b antikoerper, atxn1 antikoerper, 2900016G23Rik antikoerper, Atx1 antikoerper, C85907 antikoerper, ENSMUSG00000074917 antikoerper, Gm10786 antikoerper, Sca1 antikoerper, CG4547 antikoerper, Dmel\\CG4547 antikoerper, dAtx-1 antikoerper, dAtx1 antikoerper, sca1 antikoerper, ataxin 1 antikoerper, ataxin 1b antikoerper, Ataxin 1 antikoerper, ATXN1 antikoerper, atxn1b antikoerper, Atxn1 antikoerper, Atx-1 antikoerper
- Hintergrund
-
Name/Gene ID: ATXN1
Synonyms: ATXN1, ATX1, Ataxin 1, D6S504E, Ataxin-1, SCA1 - Gen-ID
- 6310
- Pathways
- Synaptic Membrane
-