Thymosin beta-15 (AA 1-45) Antikörper

Produktnummer ABIN109918

Produktdetails

Target: Thymosin beta-15

Bindungsspezifität: AA 1-45

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Applikation: ELISA

Spezifität: Human Thymosin 6153815 (aa 1-45)

Immunogen: Synthetic human Thymosin 6153815 (aa 1-45) KLH conjugated (MGDRPDLSEVERFDKSKLKKTITEVKNTLPSKETIEQEKEFVKRS)

Anwendungsinformationen

Applikationshinweise: ELISA (1/80.000) This antibody has not been tested for use in all applications. This does not necessarily exclude its use for non-tested procedures. The stated dilutions are recommendations only. We suggest that the applicant titrates the antibody in his/her system using appropriate negative/positive controls.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Resuspend in aqua bidest.

Lagerung: 4 °C

Antigendetails

Target: Thymosin beta-15

Andere Bezeichnung: Thymosin beta15

Hintergrund: Serum