Parathyroid Hormone 2 (PTH2) Antikörper
-
- Target Alle Parathyroid Hormone 2 (PTH2) Antikörper anzeigen
- Parathyroid Hormone 2 (PTH2)
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Unkonjugiert
-
Applikation
- ELISA, Radioimmunoassay (RIA)
- Spezifität
- Human, bovine, canis TIP 39
- Immunogen
- synthetic human TIP 39 (aa 62-100) bTG conjugated (SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP)
- Top Product
- Discover our top product PTH2 Primärantikörper
-
-
- Applikationshinweise
- ELISA (1/4.000) RIA (1/ 2.000) This antibody has not been tested for use in all applications. This does not necessarily exclude its use for non-tested procedures. The stated dilutions are recommendations only. We suggest that the applicant titrates the antibody in his/her system using appropriate negative/positive controls.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Resuspend in aqua bidest.
- Lagerung
- 4 °C
-
- Target
- Parathyroid Hormone 2 (PTH2)
- Andere Bezeichnung
- TIP 39 (PTH2 Produkte)
- Synonyme
- TIP39 antikoerper, Tifp39 antikoerper, Tip39 antikoerper, RGD1559447 antikoerper, pth2 antikoerper, parathyroid hormone 2 antikoerper, parathyroid hormone 1b antikoerper, tuberoinfundibular 39 residue protein antikoerper, PTH2 antikoerper, Pth2 antikoerper, pth1b antikoerper, TIP39 antikoerper
- Hintergrund
- Serum
- Pathways
- Sensory Perception of Sound, cAMP Metabolic Process, Regulation of Muscle Cell Differentiation, Tube Formation, Skeletal Muscle Fiber Development
-