IL-1 beta Antikörper (N-Term)

Produktnummer ABIN634267

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch IL-1 beta in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für IL-1 beta Antikörper (N-Term) (ABIN634267)

Target: IL-1 beta (IL1B) (Interleukin 1, beta (IL1B))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IL-1 beta Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-IL-1 beta Antikörper

Bindungsspezifität: N-Term

Spezifität: IL1 beta antibody was raised against the N terminal of IL1 B

Aufreinigung: Affinity purified

Immunogen: IL1 beta antibody was raised using the N terminal of IL1 B corresponding to a region with amino acids MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IL1 beta Blocking Peptide, (ABIN5614166), is also available for use as a blocking control in assays to test for specificity of this IL1 beta antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IL-1 beta

Target: IL-1 beta (IL1B) (Interleukin 1, beta (IL1B))

Andere Bezeichnung: IL1 beta

Hintergrund: IL1B is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity. The gene encoding IL1B and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2.

Molekulargewicht: 17 kDa (MW of target protein)

Pathways: NF-kappaB Signalweg, Interferon-gamma Pathway, TLR Signalweg, Negative Regulation of Hormone Secretion, Cellular Response to Molecule of Bacterial Origin, Carbohydrate Homeostasis, Glycosaminoglycan Metabolic Process, Myometrial Relaxation and Contraction, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Autophagie, Cancer Immune Checkpoints, Inflammasome