HRAS Antikörper (C-Term)
-
- Target Alle HRAS Antikörper anzeigen
- HRAS (HRas proto-oncogene, GTPase (HRAS))
-
Bindungsspezifität
- AA 101-137, C-Term
-
Reaktivität
- Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HRAS Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for GTPase Hras(HRAS) detection. Tested with WB in Human,Mouse,Rat.
- Sequenz
- KRVKDSDDVP MVLVGNKCDL AARTVESRQA QDLAR
- Kreuzreaktivität (Details)
-
Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities. - Produktmerkmale
-
Rabbit IgG polyclonal antibody for GTPase Hras(HRAS) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: Harvey rat sarcoma viral oncogene homolog
Protein Name: GTPase Hras - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human GTPase HRAS (101-137aa KRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLAR SY), identical to the related mouse and rat sequences.
- Isotyp
- IgG
- Top Product
- Discover our top product HRAS Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- HRAS (HRas proto-oncogene, GTPase (HRAS))
- Andere Bezeichnung
- HRAS (HRAS Produkte)
- Hintergrund
-
GTPase HRas, also known as transforming protein p21, is an enzyme that in humans is encoded by the HRAS gene. This gene belongs to the Ras oncogene family, whose members are related to the transforming genes of mammalian sarcoma retroviruses. The products encoded by these genes function in signal transduction pathways. These proteins can bind GTP and GDP, and they have intrinsic GTPase activity. This protein undergoes a continuous cycle of de- and re-palmitoylation, which regulates its rapid exchange between the plasma membrane and the Golgi apparatus. Mutations in this gene cause Costello syndrome, a disease characterized by increased growth at the prenatal stage, growth deficiency at the postnatal stage, predisposition to tumor formation, mental retardation, skin and musculoskeletal abnormalities, distinctive facial appearance and cardiovascular abnormalities. Defects in this gene are implicated in a variety of cancers, including bladder cancer, follicular thyroid cancer, and oral squamous cell carcinoma. Multiple transcript variants, which encode different isoforms, have been identified for this gene.
Synonyms: C BAS/HAS antibody|c H ras antibody|C HA RAS1 antibody|c has/bas p21 protein antibody|c ras Ki 2 activated oncogene antibody|c-H-ras antibody|CTLO antibody|GTP and GDP binding peptide B antibody|GTPase HRas, N-terminally processed antibody|H Ras 1 antibody|H RASIDX antibody|H-Ras-1 antibody|Ha Ras antibody|Ha Ras1 proto oncoprotein antibody|Ha-Ras antibody|HAMSV antibody|Harvey rat sarcoma viral oncogene homolog antibody|Harvey rat sarcoma viral oncoprotein antibody|HRAS antibody|HRAS1 antibody|K ras antibody|N ras antibody|p19 H RasIDX protein antibody|p21ras antibody|Ras family small GTP binding protein H Ras antibody|RASH_HUMAN antibody|RASH1 antibody| Transformation gene oncogene HAMSV antibody|Transforming protein p21 antibody|v Ha ras Harvey rat sarcoma viral oncogene homolog antibody|VH Ras antibody|vHa RAS antibody - Gen-ID
- 3265
- UniProt
- P01112
- Pathways
- p53 Signalweg, MAPK Signalweg, RTK Signalweg, Fc-epsilon Rezeptor Signalübertragung, EGFR Signaling Pathway, Neurotrophin Signalübertragung, Hepatitis C, Autophagie, Signaling Events mediated by VEGFR1 and VEGFR2, Signaling of Hepatocyte Growth Factor Receptor, Regulation of long-term Neuronal Synaptic Plasticity, VEGF Signaling, BCR Signaling
-