Telefon:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@antikoerper-online.de

ERK1 Antikörper (AA 372-406)

MAPK3 Reaktivität: Maus, Ratte, Kaninchen, Hamster WB, IP, Func Wirt: Kaninchen Polyclonal unconjugated
Produktnummer ABIN199418
  • Target Alle ERK1 (MAPK3) Antikörper anzeigen
    ERK1 (MAPK3) (Mitogen-Activated Protein Kinase 3 (MAPK3))
    Bindungsspezifität
    • 80
    • 55
    • 23
    • 18
    • 16
    • 15
    • 15
    • 11
    • 11
    • 9
    • 9
    • 8
    • 6
    • 5
    • 5
    • 5
    • 5
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 372-406
    Reaktivität
    • 238
    • 170
    • 140
    • 46
    • 20
    • 18
    • 18
    • 13
    • 12
    • 11
    • 11
    • 7
    • 7
    • 6
    • 5
    • 3
    • 3
    • 3
    • 1
    • 1
    • 1
    • 1
    Maus, Ratte, Kaninchen, Hamster
    Wirt
    • 245
    • 28
    • 4
    • 1
    • 1
    Kaninchen
    Klonalität
    • 221
    • 58
    Polyklonal
    Konjugat
    • 119
    • 23
    • 20
    • 18
    • 10
    • 9
    • 7
    • 7
    • 7
    • 7
    • 7
    • 7
    • 5
    • 5
    • 5
    • 5
    • 5
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    Dieser ERK1 Antikörper ist unkonjugiert
    Applikation
    • 231
    • 94
    • 75
    • 68
    • 65
    • 46
    • 42
    • 39
    • 35
    • 24
    • 18
    • 12
    • 12
    • 5
    • 3
    • 2
    • 1
    • 1
    Western Blotting (WB), Immunoprecipitation (IP), Functional Studies (Func)
    Spezifität
    Recognizes rat MAPK1/Erk1 at 44kD and MAPK2/Erk2 at 42kD. Species cross-reactivity: Human, mouse, chicken and starfish. Species sequence Homology: Chinese hamster: 35/35, mouse: 34/35, human: 32/35.
    Homologie
    Percent identity by BLAST analysis: Marmoset, Mouse, Rat, Hamster, Panda, Rabbit, Opossum (100%) Monkey, Bovine, Dog, Bat, Horse, Platypus (97%) Human, Gorilla, Gibbon, Elephant (94%) Orangutan, Pig, Turkey, Chicken, Pufferfish, Zebrafish (87%) Xenopus (84%).
    Aufreinigung
    Immunoaffinity purified
    Immunogen
    Synthetic peptide (CGG-PFTFDMELDDLPKERLKELIFQETARFQPGAPEAP) corresponding to the C-terminal 35 amino acids of rat 44kD MAP Kinase 2/ Erk2 (KLH coupled). Percent identity by BLAST analysis: Marmoset, Mouse, Rat, Hamster, Panda, Rabbit, Opossum (100%), Monkey, Bovine, Dog, Bat, Horse, Platypus (97%), Human, Gorilla, Gibbon, Elephant (94%), Orangutan, Pig, Turkey, Chicken, Pufferfish, Zebrafish (87%), Xenopus (84%).

    Type of Immunogen: Synthetic peptide - KLH conjugated
    Isotyp
    IgG
    Top Product
    Discover our top product MAPK3 Primärantikörper
  • Applikationshinweise
    Approved: Func, IP, WB (0.1 - 2 μg/mL)

    Usage: Suitable for use in Western Blot and Immunoprecipitation. Western Blot: 0.1-2 μg/mL detects MAP kinases in RIPA lysates of mouse 3T3/A31 fibroblasts and L6 cells. 3T3/A31 cell lysate was resolved by electrophoresis, transferred to nitrocellulose and probed with anti-MAP Kinase 1/2 (0.1 μg/mL). Proteins were visualized using a goat anti-rabbit secondary antibody conjugated to HRP and a chemiluminescence detection system. Immunoprecipitation Kinase Assay: 4 μg immunoprecipitates active MAP kinases from a lysate of NGF-stimulated (50 ng/mL) PC-12 cells, as demonstrated using the MAPK Immunoprecipitation Kinase Cascade Kit.
    Kommentare

    Target Species of Antibody: Rat

    Beschränkungen
    Nur für Forschungszwecke einsetzbar
  • Format
    Liquid
    Konzentration
    Lot specific
    Buffer
    0.2 M Tris-glycine,  pH 7.4, 0.15 M sodium chloride, 0.05 % sodium azide, 0.1 mM EDTA.
    Konservierungsmittel
    Sodium azide
    Vorsichtsmaßnahmen
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Handhabung
    Avoid repeat freeze-thaw cycles.
    Lagerung
    4 °C,-20 °C
    Informationen zur Lagerung
    Short term: 4°C. Long term: Store at -20°C. Avoid freeze-thaw cycles.
  • Target
    ERK1 (MAPK3) (Mitogen-Activated Protein Kinase 3 (MAPK3))
    Andere Bezeichnung
    MAPK3 / ERK1 (MAPK3 Produkte)
    Synonyme
    ERK-1 antikoerper, ERK1 antikoerper, ERT2 antikoerper, HS44KDAP antikoerper, HUMKER1A antikoerper, P44ERK1 antikoerper, P44MAPK antikoerper, PRKM3 antikoerper, p44-ERK1 antikoerper, p44-MAPK antikoerper, Erk-1 antikoerper, Erk1 antikoerper, Ert2 antikoerper, Esrk1 antikoerper, Mnk1 antikoerper, Mtap2k antikoerper, Prkm3 antikoerper, p44 antikoerper, p44erk1 antikoerper, p44mapk antikoerper, ERK3 antikoerper, ERK6 antikoerper, P38GAMMA antikoerper, PRKM12 antikoerper, SAPK-3 antikoerper, SAPK3 antikoerper, fi06b09 antikoerper, wu:fi06b09 antikoerper, zERK1 antikoerper, Tb08.10J17.940 antikoerper, MAPK1 antikoerper, MNK1 antikoerper, AW123708 antikoerper, Erk6 antikoerper, P38gamma antikoerper, Prkm12 antikoerper, Sapk3 antikoerper, ATMAPK3 antikoerper, ATMPK3 antikoerper, T6D9.4 antikoerper, mitogen-activated protein kinase 3 antikoerper, mitogen-activated protein kinase 3 antikoerper, mitogen-activated protein kinase 12 antikoerper, mitogen activated protein kinase 3 antikoerper, mitogen-activated serine/threonine-protein kinase antikoerper, MAPK3 antikoerper, Mapk3 antikoerper, MAPK12 antikoerper, mapk3 antikoerper, Tc00.1047053509475.10 antikoerper, Tb927.8.3550 antikoerper, Mapk12 antikoerper, CEK1 antikoerper, MPK3 antikoerper
    Hintergrund
    Name/Gene ID: MAPK3
    Subfamily: MAPK
    Family: Protein Kinase

    Synonyms: MAPK3, ERK-1, ERT2, HUMKER1A, HS44KDAP, MAP kinase 1, MAP kinase isoform p44, MAPK 1, MAPK 3, p44, p44MAPK, p44-MAPK, p44ERK1, Insulin-stimulated MAP2 kinase, MAP kinase 3, p44-ERK1, ERK1, PRKM3
    Gen-ID
    5595
    UniProt
    P27361
    Pathways
    MAPK Signalweg, RTK Signalweg, Interferon-gamma Pathway, Fc-epsilon Rezeptor Signalübertragung, Neurotrophin Signalübertragung, Response to Growth Hormone Stimulus, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Hepatitis C, Protein targeting to Nucleus, Toll-Like Receptors Cascades, Signaling Events mediated by VEGFR1 and VEGFR2, Signaling of Hepatocyte Growth Factor Receptor, VEGFR1 Specific Signals, S100 Proteine
Sie sind hier:
Kundenservice