anti-Maus COL4a3 Antikörper für Immunofluorescence

Recommended COL4a3 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Collagen, Type IV, alpha 3 (COL4a3) Antikörper
  • zTumstatin
  • [a]3(IV)
  • alpha3(IV)
  • collagen, type IV, alpha 3 (Goodpasture antigen)
  • collagen, type IV, alpha 3
  • COL4A3
  • col4a3
  • Col4a3
Reaktivität
Human, Maus
59
28
19
3
3
3
3
2
2
2
1
1
1
Wirt
Kaninchen
55
4
Klonalität
Polyklonal
Konjugat
Dieser COL4a3 Antikörper ist unkonjugiert
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
31
22
15
13
5
3
1
1
1
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4363552
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
11.917223 ABIN1106754 EIA IHC (fro) IF WB Rabbit C-Term, Chain alpha 3 Anmelden zum Anzeigen Polyclonal

General

Antigen Collagen, Type IV, alpha 3 (COL4a3) Antikörper
Reaktivität Human, Maus
(59), (28), (19), (3), (3), (3), (3), (2), (2), (2), (1), (1), (1)
Wirt Kaninchen
(55), (4)
Klonalität
Polyklonal
Konjugat Dieser COL4a3 Antikörper ist unkonjugiert
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(31), (22), (15), (13), (5), (3), (1), (1), (1), (1), (1)
Pubmed 1 Publikation vorhanden
Hersteller Anmelden zum Anzeigen

Produktdetails anti-COL4a3 Antikörper

Target Details COL4a3 Anwendungsinformationen Handhabung Referenzen für anti-COL4a3 Antikörper (ABIN4363552) Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KDGVPGFPGSEGVKGNRGFPGLMGEDGIKGQKGDIGPPGFRGPTEYYDTYQEKGDEGTPGPPGPRGARG
Isotyp IgG

Target Details COL4a3

Produktdetails anti-COL4a3 Antikörper Anwendungsinformationen Handhabung Referenzen für anti-COL4a3 Antikörper (ABIN4363552) Bilder zurück nach oben
Antigen
Andere Bezeichnung Tumstatin/COL4A3 (COL4a3 Antibody Abstract)
Hintergrund Gene Symbol: COL4A3
Gen-ID 1285
Pathways Sensory Perception of Sound, Positive Regulation of Endopeptidase Activity

Anwendungsinformationen

Produktdetails anti-COL4a3 Antikörper Target Details COL4a3 Handhabung Referenzen für anti-COL4a3 Antikörper (ABIN4363552) Bilder zurück nach oben
Applikationshinweise Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin 1:50-1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-COL4a3 Antikörper Target Details COL4a3 Anwendungsinformationen Referenzen für anti-COL4a3 Antikörper (ABIN4363552) Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Referenzen für anti-COL4a3 Antikörper (ABIN4363552)

Produktdetails anti-COL4a3 Antikörper Target Details COL4a3 Anwendungsinformationen Handhabung Bilder zurück nach oben
Produkt verwendet in:

Jeruschke, Jeruschke, DiStasio, Karaterzi, Büscher, Nalbant, Klein-Hitpass, Hoyer, Weiss, Stottmann, Weber: "Everolimus Stabilizes Podocyte Microtubules via Enhancing TUBB2B and DCDC2 Expression." in: PLoS ONE, Vol. 10, Issue 9, pp. e0137043, 2015 Weitere Details: Western Blotting

Bilder

Produktdetails anti-COL4a3 Antikörper Target Details COL4a3 Anwendungsinformationen Handhabung Referenzen für anti-COL4a3 Antikörper (ABIN4363552) zurück nach oben
Bilder des Herstellers
Immunofluorescence (IF) image for anti-Collagen, Type IV, alpha 3 (COL4a3) antibody (ABIN4363552) Immunocytochemistry/Immunofluorescence: Tumstatin/COL4A3 Antibody - Staining of huma...
Immunofluorescence (IF) image for anti-Collagen, Type IV, alpha 3 (COL4a3) antibody (ABIN4363552) Immunocytochemistry/Immunofluorescence: Tumstatin/COL4A3 Antibody - Immunofluorescen...