anti-Human ROS1 Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended ROS1 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
C-Ros Oncogene 1 , Receptor tyrosine Kinase (ROS1) Antikörper
  • MCF3
  • ROS
  • c-ros-1
  • ROS1C
  • Ros-1
  • c-ros
  • c-ros oncogene 1 , receptor tyrosine kinase
  • Ros1 proto-oncogene
  • ROS1
  • Ros1
Reaktivität
Human
181
7
5
3
3
3
3
2
Wirt
Kaninchen
144
30
11
Klonalität
Polyklonal
Konjugat
Dieser ROS1 Antikörper ist unkonjugiert
9
8
8
8
6
6
6
6
6
6
6
6
6
6
6
6
6
6
2
2
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
154
102
35
23
16
15
14
8
6
6
2
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4350968
335,00 €
Zzgl. Versandkosten 20,00 € und MWSt
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
13.400779 ABIN4350969 IHC (p) WB Rabbit N-Term Anmelden zum Anzeigen Polyclonal
1 ABIN5552251 EIA IF IHC (p) WB Rabbit Ig Fraction AA 33-63, N-Term Anmelden zum Anzeigen Polyclonal
1 ABIN2579392 IHC (p) WB Mouse IgG2b AA 2126-2347 Anmelden zum Anzeigen 1F6
1 ABIN2579393 IHC (p) WB Mouse IgG1 AA 2126-2347 Anmelden zum Anzeigen 1F3
1 ABIN2579397 IHC (p) Mouse IgG1 AA 2126-2347 Anmelden zum Anzeigen 4A4
1 ABIN2579403 IHC (p) Mouse IgG2b AA 2126-2347 Anmelden zum Anzeigen 2A8
1 ABIN2579405 IHC (p) Mouse IgG2a AA 2126-2347 Anmelden zum Anzeigen 3F12
1 ABIN2579404 IHC (p) WB Mouse IgG2a AA 2126-2347 Anmelden zum Anzeigen 5D1
1 ABIN1931460 ELISA ICC IF IHC IHC (p) WB APC Rabbit IgG AA 33-63 Anmelden zum Anzeigen Polyclonal
1 ABIN1931459 ELISA ICC IF IHC IHC (p) WB Alkaline Phosphatase (AP) Rabbit IgG AA 33-63 Anmelden zum Anzeigen Polyclonal
1 ABIN1931461 ELISA ICC IF IHC IHC (p) WB Biotin Rabbit IgG AA 33-63 Anmelden zum Anzeigen Polyclonal
1 ABIN1931463 ELISA ICC IF IHC IHC (p) WB PE Rabbit IgG AA 33-63 Anmelden zum Anzeigen Polyclonal
1 ABIN1931462 ELISA ICC IF IHC IHC (p) WB FITC Rabbit IgG AA 33-63 Anmelden zum Anzeigen Polyclonal
1 ABIN1931464 ELISA ICC IF IHC IHC (p) WB HRP Rabbit IgG AA 33-63 Anmelden zum Anzeigen Polyclonal
1 ABIN2579391 ELISA IF IHC (p) WB Rabbit IgG AA 33-63 Anmelden zum Anzeigen Polyclonal
1 ABIN1841192 IHC (p) WB Rabbit AA 23-56 Anmelden zum Anzeigen Polyclonal

Ähnliche anti-ROS1 Antikörper

Applikation / Reaktivität Human
Cytometry by Time of Flight (CyTOF) 6 Antikörper
ELISA 22 Antikörper
Enzyme Immunoassay (EIA) 1 Antikörper
Flow Cytometry (FACS) 102 Antikörper
Functional Studies (Func) 6 Antikörper
Immunocytochemistry (ICC) 13 Antikörper
Immunofluorescence (IF) 15 Antikörper
Immunofluorescence (fixed cells) (IF/ICC) 1 Antikörper
Immunohistochemistry (IHC) 34 Antikörper
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 17 Antikörper
Immunoprecipitation (IP) 7 Antikörper
Western Blotting (WB) 150 Antikörper

General

Antigen C-Ros Oncogene 1 , Receptor tyrosine Kinase (ROS1) Antikörper
Reaktivität Human
(181), (7), (5), (3), (3), (3), (3), (2)
Wirt Kaninchen
(144), (30), (11)
Klonalität
Polyklonal
Konjugat Dieser ROS1 Antikörper ist unkonjugiert
(9), (8), (8), (8), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (2), (2)
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(154), (102), (35), (23), (16), (15), (14), (8), (6), (6), (2), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-ROS1 Antikörper

Target Details ROS1 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: WKYNEFYHVKTSCSQGPAYVCNITNLQPYTSYNVRVVVVYKTGENSTSLP ESFKTKAGVPNKPGIPKLLEGSKNSIQWEKAEDNGC
Isotyp IgG

Target Details ROS1

Produktdetails anti-ROS1 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung ROS (ROS1 Antibody Abstract)
Hintergrund Gene Symbol: ROS1
Gen-ID 6098
Forschungsgebiet Transcription Factors, Cancer, Tyrosine Kinases
Pathways RTK Signalweg

Anwendungsinformationen

Produktdetails anti-ROS1 Antikörper Target Details ROS1 Handhabung Bilder zurück nach oben
Applikationshinweise Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH 6 antigen retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-ROS1 Antikörper Target Details ROS1 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-ROS1 Antikörper Target Details ROS1 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-ROS1 Antikörper (C-Ros Oncogene 1 , Receptor tyrosine Kinase) (ABIN4350968) Immunohistochemistry-Paraffin: ROS Antibody [NBP2-13245] Staining of human kidney sho...