anti-Human EPGN Antikörper für Immunocytochemistry

Recommended EPGN Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Epithelial Mitogen Homolog (Mouse) (EPGN) Antikörper
  • ALGV3072
  • EPG
  • PRO9904
  • 2310069M11Rik
  • epigen
  • RGD1560084
  • epithelial mitogen
  • epithelial mitogen homolog (mouse)
  • EPGN
  • Epgn
Reaktivität
Human
40
32
18
Wirt
Kaninchen
41
15
Klonalität
Polyklonal
Konjugat
Dieser EPGN Antikörper ist unkonjugiert
4
4
3
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF)
42
17
17
13
3
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN5076553
335,00 €
Zzgl. Versandkosten 20,00 € und MWSt

Ähnliche anti-EPGN Antikörper

Applikation / Reaktivität Human
ELISA 16 Antikörper
Enzyme Immunoassay (EIA) 1 Antikörper
Flow Cytometry (FACS) 17 Antikörper
Immunocytochemistry (ICC) 1 Antikörper
Immunofluorescence (IF) 1 Antikörper
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 13 Antikörper
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 3 Antikörper
Western Blotting (WB) 26 Antikörper

General

Antigen Epithelial Mitogen Homolog (Mouse) (EPGN) Antikörper
Reaktivität Human
(40), (32), (18)
Wirt Kaninchen
(41), (15)
Klonalität
Polyklonal
Konjugat Dieser EPGN Antikörper ist unkonjugiert
(4), (4), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF)
(42), (17), (17), (13), (3), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-EPGN Antikörper

Target Details EPGN Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ALTEEAAVTVTPPITAQQGNWTVNKTEADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGYTGERCEHLTLTSYAVDSYE
Isotyp IgG

Target Details EPGN

Produktdetails anti-EPGN Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung EPGN (EPGN Antibody Abstract)
Hintergrund Gene Symbol: EPGN
Gen-ID 255324
Pathways RTK Signalweg, EGFR Signaling Pathway

Anwendungsinformationen

Produktdetails anti-EPGN Antikörper Target Details EPGN Handhabung Bilder zurück nach oben
Applikationshinweise Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-EPGN Antikörper Target Details EPGN Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-EPGN Antikörper Target Details EPGN Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunofluorescence (IF) image for anti-EPGN Antikörper (Epithelial Mitogen Homolog (Mouse)) (ABIN5076553) Immunocytochemistry/Immunofluorescence: EPGN Antibody - Staining of human cell line ...