anti-Human s100b Antikörper für Immunofluorescence

Recommended s100b Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
S100 Calcium Binding Protein B (S100B) Antikörper
  • AI266795
  • S100
  • S100a
  • NEF
  • S100-B
  • S100beta
  • S100P
  • AI850290
  • Bpb
  • S100 calcium binding protein A1
  • S100 calcium binding protein B
  • S100 protein, beta polypeptide, neural
  • S100a1
  • S100B
  • S100b
Reaktivität
Human, Maus
446
262
226
203
44
32
8
2
2
1
1
1
1
1
Wirt
Kaninchen
295
183
8
4
3
Klonalität
Polyklonal
Konjugat
Dieser s100b Antikörper ist unkonjugiert
33
27
16
13
12
11
10
10
10
10
10
10
10
10
9
9
6
4
4
4
3
3
2
1
1
1
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
361
237
221
202
183
176
130
24
13
13
9
7
5
5
4
2
2
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4351813
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
11.948647 ABIN4351815 FACS ICC IF IHC IHC (p) WB Mouse IgG2b kappa Anmelden zum Anzeigen 15F4NB 1
11.948647 ABIN4351819 FACS ICC IF IHC IHC (p) WB Mouse IgG2b kappa Anmelden zum Anzeigen 15F9NB
11.948647 ABIN4351817 FACS ICC IF IHC IHC (p) WB Mouse IgG2b kappa Anmelden zum Anzeigen 15F4NB
11.948647 ABIN4351821 FACS ICC IF IHC IHC (p) WB Mouse IgG2b kappa Anmelden zum Anzeigen 15F9NB
1 ABIN1108929 IF IP WB Mouse IgG1 Anmelden zum Anzeigen SA-12 2
1 ABIN448390 ICC IF IHC IHC (p) WB Mouse IgG1 Anmelden zum Anzeigen SA-12 2
1 ABIN4242945 FACS ICC IF IHC IHC (p) WB Alexa Fluor 488 Mouse IgG2b kappa Anmelden zum Anzeigen 15F4NB
1 ABIN5079454 FACS ICC IF IHC (p) WB Mouse IgG2a kappa Anmelden zum Anzeigen S100B-1012
1 ABIN5079455 FACS ICC IF IHC (p) WB Mouse IgG2a kappa Anmelden zum Anzeigen S100B-1012
1 ABIN5079456 FACS ICC IF IHC (p) WB Mouse IgG2a kappa Anmelden zum Anzeigen S100B-1012
1 ABIN4963556 FACS ICC IF IHC (p) WB Mouse IgG2a kappa Anmelden zum Anzeigen 4C4-9
1 ABIN4963558 FACS ICC IF IHC (p) WB Mouse IgG2a kappa Anmelden zum Anzeigen 4C4-9
1 ABIN4963557 FACS ICC IF IHC (p) WB Mouse IgG2a kappa Anmelden zum Anzeigen 4C4-9
1 ABIN4963559 FACS ICC IF IHC (p) WB Mouse IgG2a kappa Anmelden zum Anzeigen S100B-1012
1 ABIN4963560 FACS ICC IF IHC (p) WB Mouse IgG2a kappa Anmelden zum Anzeigen S100B-1012
1 ABIN4963570 FACS ICC IF IHC (p) WB Mouse IgG2a kappa Anmelden zum Anzeigen SPM354
1 ABIN4963572 FACS ICC IF IHC (p) WB Mouse IgG1 kappa Anmelden zum Anzeigen SH-B1
1 ABIN4963573 FACS ICC IF IHC (p) WB Mouse IgG1 kappa Anmelden zum Anzeigen SH-B1
1 ABIN4963562 FACS ICC IF IHC (p) WB Mouse IgG2a kappa Anmelden zum Anzeigen 4C4-9-S100B-1012
1 ABIN4963563 FACS ICC IF IHC (p) WB Mouse IgG2a kappa Anmelden zum Anzeigen 4C4-9-S100B-1012

General

Antigen S100 Calcium Binding Protein B (S100B) Antikörper
Reaktivität Human, Maus
(446), (262), (226), (203), (44), (32), (8), (2), (2), (1), (1), (1), (1), (1)
Wirt Kaninchen
(295), (183), (8), (4), (3)
Klonalität
Polyklonal
Konjugat Dieser s100b Antikörper ist unkonjugiert
(33), (27), (16), (13), (12), (11), (10), (10), (10), (10), (10), (10), (10), (10), (9), (9), (6), (4), (4), (4), (3), (3), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(361), (237), (221), (202), (183), (176), (130), (24), (13), (13), (9), (7), (5), (5), (4), (2), (2), (1), (1)
Pubmed 6 Publikationen vorhanden
Hersteller Anmelden zum Anzeigen

Produktdetails anti-s100b Antikörper

Target Details s100b Anwendungsinformationen Handhabung Referenzen für anti-s100b Antikörper (ABIN4351813) Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
Isotyp IgG

Target Details s100b

Produktdetails anti-s100b Antikörper Anwendungsinformationen Handhabung Referenzen für anti-s100b Antikörper (ABIN4351813) Bilder zurück nach oben
Antigen
Andere Bezeichnung S100B (S100B Antibody Abstract)
Hintergrund Gene Symbol: S100B
Gen-ID 6285
Pathways Regulation of Muscle Cell Differentiation, Positive Regulation of Immune Effector Process, Toll-Like Receptors Cascades, Regulation of long-term Neuronal Synaptic Plasticity

Anwendungsinformationen

Produktdetails anti-s100b Antikörper Target Details s100b Handhabung Referenzen für anti-s100b Antikörper (ABIN4351813) Bilder zurück nach oben
Applikationshinweise Western Blot 1:100-1:500, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:1000-1:2500This antibody is useful for Immunohistochemistry-Paraffin and Western Blot. For IHC-Paraffin HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-s100b Antikörper Target Details s100b Anwendungsinformationen Referenzen für anti-s100b Antikörper (ABIN4351813) Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Referenzen für anti-s100b Antikörper (ABIN4351813)

Produktdetails anti-s100b Antikörper Target Details s100b Anwendungsinformationen Handhabung Bilder zurück nach oben
Produkt verwendet in:

Zhou, Cui, Su, Wang, Guo: "Beneficial reciprocal effects of bone marrow stromal cells and Schwann cells from adult rats in a dynamic co‑culture system in vitro without intercellular contact." in: Molecular medicine reports, Vol. 12, Issue 4, pp. 4931-8, 2015 Weitere Details: Immunocytochemistry,Immunofluorescence

Darcy, Trouche, Jin, Feig: "Age-dependent role for Ras-GRF1 in the late stages of adult neurogenesis in the dentate gyrus." in: Hippocampus, Vol. 24, Issue 3, pp. 315-25, 2014 (Probematerial (Species): Mouse (Murine)). Weitere Details: Immunohistochemistry

Kielar, Tuy, Bizzotto, Lebrand, de Juan Romero, Poirier, Oegema, Mancini, Bahi-Buisson, Olaso, Le Moing, Boutourlinsky, Boucher, Carpentier, Berquin, Deleuze, Belvindrah, Borrell, Welker, Chelly et al.: "Mutations in Eml1 lead to ectopic progenitors and neuronal heterotopia in mouse and human. ..." in: Nature neuroscience, Vol. 17, Issue 7, pp. 923-33, 2014

Hanson, Fregoso, Vrana, Tucker, Niswander: "Peripheral nervous system defects in a mouse model for peroxisomal biogenesis disorders." in: Developmental biology, Vol. 395, Issue 1, pp. 84-95, 2014 (Probematerial (Species): Mouse (Murine)). Weitere Details: Immunohistochemistry

Uhlén, Oksvold, Älgenäs, Hamsten, Fagerberg, Klevebring, Lundberg, Odeberg, Pontén, Kondo, Sivertsson: "Antibody-based protein profiling of the human chromosome 21." in: Molecular & cellular proteomics : MCP, Vol. 11, Issue 3, pp. M111.013458, 2012

Chaichana, Guerrero-Cazares, Capilla-Gonzalez, Zamora-Berridi, Achanta, Gonzalez-Perez, Jallo, Garcia-Verdugo, Quiñones-Hinojosa: "Intra-operatively obtained human tissue: protocols and techniques for the study of neural stem cells." in: Journal of neuroscience methods, Vol. 180, Issue 1, pp. 116-25, 2009

Bilder

Produktdetails anti-s100b Antikörper Target Details s100b Anwendungsinformationen Handhabung Referenzen für anti-s100b Antikörper (ABIN4351813) zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-S100 Calcium Binding Protein B (S100B) antibody (ABIN4351813) Western Blot: S100B Antibody [NBP1-87102] - Lane 1: Marker [kDa] 250, 130, 100, 70, 5...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-S100 Calcium Binding Protein B (S100B) antibody (ABIN4351813) Immunohistochemistry-Paraffin: S100B Antibody [NBP1-87102] - Immunohistochemical stai...
Western Blotting (WB) image for anti-S100 Calcium Binding Protein B (S100B) antibody (ABIN4351813) Western Blot: S100B Antibody [NBP1-87102] - Lane 1: Marker [kDa] 250, 130, 100, 70, 5...
Immunofluorescence (IF) image for anti-S100 Calcium Binding Protein B (S100B) antibody (ABIN4351813) Immunocytochemistry/Immunofluorescence: S100B Antibody [NBP1-87102] - Staining of hum...
Western Blotting (WB) image for anti-S100 Calcium Binding Protein B (S100B) antibody (ABIN4351813) Western Blot: S100B Antibody [NBP1-87102] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-S100 Calcium Binding Protein B (S100B) antibody (ABIN4351813) Immunohistochemistry-Paraffin: S100B Antibody - Staining of human cerebral cortex sh...