anti-Human PPM1D Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended PPM1D Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Protein Phosphatase, Mg2+/Mn2+ Dependent, 1D (PPM1D) Antikörper
  • AV338790
  • Wip1
  • PP2C-DELTA
  • WIP1
  • protein phosphatase 1D magnesium-dependent, delta isoform
  • protein phosphatase, Mg2+/Mn2+ dependent, 1D
  • Ppm1d
  • PPM1D
Reaktivität
Human
73
20
18
1
Wirt
Kaninchen
66
8
Klonalität
Polyklonal
Konjugat
Dieser PPM1D Antikörper ist unkonjugiert
5
5
4
4
4
4
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
55
32
13
8
4
3
3
2
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4347049
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN740415 IF (p) IHC (p) WB Rabbit IgG AA 220-260 Anmelden zum Anzeigen Polyclonal 1
1 ABIN740424 IHC (p) WB HRP Rabbit IgG AA 220-260 Anmelden zum Anzeigen Polyclonal
1 ABIN740417 IHC (p) WB Biotin Rabbit IgG AA 220-260 Anmelden zum Anzeigen Polyclonal

General

Antigen Protein Phosphatase, Mg2+/Mn2+ Dependent, 1D (PPM1D) Antikörper
Reaktivität Human
(73), (20), (18), (1)
Wirt Kaninchen
(66), (8)
Klonalität
Polyklonal
Konjugat Dieser PPM1D Antikörper ist unkonjugiert
(5), (5), (4), (4), (4), (4), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(55), (32), (13), (8), (4), (3), (3), (2)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-PPM1D Antikörper

Target Details PPM1D Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KHKYIILGSDGLWNMIPPQDAISMCQDQEEKKYLMGEHGQSCAKMLVNRALGRWRQRMLRADNTSAIVICISPEVDNQGNFTNEDELYLNLT
Isotyp IgG

Target Details PPM1D

Produktdetails anti-PPM1D Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung PPM1D (PPM1D Antibody Abstract)
Hintergrund Gene Symbol: PPM1D
Gen-ID 8493
Forschungsgebiet Cell Cycle, Cancer
Pathways p53 Signalweg, Zellzyklus

Anwendungsinformationen

Produktdetails anti-PPM1D Antikörper Target Details PPM1D Handhabung Bilder zurück nach oben
Applikationshinweise Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500For HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-PPM1D Antikörper Target Details PPM1D Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-PPM1D Antikörper Target Details PPM1D Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Protein Phosphatase, Mg2+/Mn2+ Dependent, 1D (PPM1D) antibody (ABIN4347049) Immunohistochemistry-Paraffin: PPM1D Antibody [NBP1-87249] - Staining of human liver ...
Immunofluorescence (IF) image for anti-Protein Phosphatase, Mg2+/Mn2+ Dependent, 1D (PPM1D) antibody (ABIN4347049) Immunocytochemistry/Immunofluorescence: PPM1D Antibody [NBP1-87249] - Staining of hum...