anti-Human ITPR1 Antikörper für Immunohistochemistry

Recommended ITPR1 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Inositol 1,4,5-Trisphosphate Receptor, Type 1 (ITPR1) Antikörper
  • D6Pas2
  • ENSMUSG00000072853
  • Gm10429
  • IP3R1
  • InsP3R
  • Ip3r
  • Itpr-1
  • P400
  • Pcp-1
  • Pcp1
  • opt
  • I145TR
  • InsP3R1
  • INSP3R1
  • IP3R
  • SCA15
  • SCA16
  • SCA29
  • inositol 1,4,5-trisphosphate receptor, type 1
  • inositol 1,4,5-trisphosphate receptor 1
  • ITPR1
  • Itpr1
Reaktivität
Human
43
42
27
1
Wirt
Kaninchen
35
25
Klonalität
Polyklonal
Konjugat
Dieser ITPR1 Antikörper ist unkonjugiert
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
44
40
28
24
11
4
3
1
1
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4327442
335,00 €
Zzgl. Versandkosten 20,00 € und MWSt
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
9.637035 ABIN1532147 IHC ELISA Rabbit IgG pSer1764 Anmelden zum Anzeigen Polyclonal
9.637035 ABIN1531671 IF IHC ELISA Rabbit IgG pSer1598 Anmelden zum Anzeigen Polyclonal
9.637035 ABIN1742107 IHC WB Rabbit C-Term, AA 2732-2750, Intracellular Anmelden zum Anzeigen Polyclonal
9.637035 ABIN1742108 IHC WB Rabbit C-Term, AA 2732-2750, Intracellular Anmelden zum Anzeigen Polyclonal
9.637035 ABIN1532695 IF IHC ELISA Rabbit IgG Anmelden zum Anzeigen Polyclonal
9.637035 ABIN2470686 IHC ELISA WB Rabbit C-Term Anmelden zum Anzeigen Polyclonal
9.637035 ABIN4327443 IHC IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
9.637035 ABIN2433225 IHC ELISA Rabbit IgG Anmelden zum Anzeigen Polyclonal
9.637035 ABIN2434854 IHC ELISA Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN439358 ICC IF IHC IHC (p) IP WB Rabbit AA 2708-2758 Anmelden zum Anzeigen Polyclonal 1
1 ABIN2290421 IC IP IHC WB Rabbit IgG AA 1829-1848, C-Term, Cytosolic Anmelden zum Anzeigen Polyclonal
1 ABIN2292842 IF IHC ELISA Rabbit IgG Internal Region Anmelden zum Anzeigen Polyclonal
1 ABIN2292850 IHC ELISA WB Rabbit C-Term Anmelden zum Anzeigen Polyclonal
1 ABIN2290419 IHC WB Rabbit IgG N-Term Anmelden zum Anzeigen Polyclonal
1 ABIN2986666 IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN2140727 IHC ELISA Rabbit IgG pSer1764 Anmelden zum Anzeigen Polyclonal
1 ABIN2764394 IHC (p) IHC ELISA Rabbit IgG Internal Region Anmelden zum Anzeigen Polyclonal
1 ABIN2770153 IHC (p) IHC ELISA WB Rabbit C-Term Anmelden zum Anzeigen Polyclonal
1 ABIN966424 IHC Anmelden zum Anzeigen Polyclonal 2
1 ABIN1577284 IHC ELISA Rabbit pSer1764 Anmelden zum Anzeigen Polyclonal

anti-ITPR1 Antikörper für Immunohistochemistry mit den meisten Publikationen

Ähnliche anti-ITPR1 Antikörper

Applikation / Reaktivität Human
ELISA 24 Antikörper
Enzyme Immunoassay (EIA) 1 Antikörper
Immunochromatography (IC) 1 Antikörper
Immunocytochemistry (ICC) 2 Antikörper
Immunofluorescence (IF) 9 Antikörper
Immunohistochemistry (IHC) 22 Antikörper
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 12 Antikörper
Immunoprecipitation (IP) 3 Antikörper
Western Blotting (WB) 25 Antikörper

General

Antigen Inositol 1,4,5-Trisphosphate Receptor, Type 1 (ITPR1) Antikörper
Reaktivität Human
(43), (42), (27), (1)
Wirt Kaninchen
(35), (25)
Klonalität
Polyklonal
Konjugat Dieser ITPR1 Antikörper ist unkonjugiert
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(44), (40), (28), (24), (11), (4), (3), (1), (1), (1), (1)
Pubmed 1 Publikation vorhanden
Hersteller Anmelden zum Anzeigen

Produktdetails anti-ITPR1 Antikörper

Target Details ITPR1 Anwendungsinformationen Handhabung ProductDetails: References for anti-ITPR1 antibody (ABIN4327442) Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:FFKVFYDRMKVAQQEIKATVTVNTSDLGNKKKDDEVDRDAPSRKKAKEPTTQITEEVRDQLLEASAATRKAFTTFRREADPDDHYQPGEGTQATADKAKDDLEMSAVITIMQPILRFLQLLCENHNRDLQNFLRC
Isotyp IgG

Target Details ITPR1

Produktdetails anti-ITPR1 Antikörper Anwendungsinformationen Handhabung ProductDetails: References for anti-ITPR1 antibody (ABIN4327442) Bilder zurück nach oben
Antigen
Andere Bezeichnung IP3R1 (ITPR1 Antibody Abstract)
Hintergrund Gene Symbol: ITPR1
Gen-ID 3708
Pathways Fc-epsilon Rezeptor Signalübertragung, EGFR Signaling Pathway, Neurotrophin Signalübertragung, Thyroid Hormone Synthesis, Myometrial Relaxation and Contraction, Synaptic Membrane, G-protein mediated Events, Interaction of EGFR with phospholipase C-gamma

Anwendungsinformationen

Produktdetails anti-ITPR1 Antikörper Target Details ITPR1 Handhabung ProductDetails: References for anti-ITPR1 antibody (ABIN4327442) Bilder zurück nach oben
Applikationshinweise Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200For HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-ITPR1 Antikörper Target Details ITPR1 Anwendungsinformationen ProductDetails: References for anti-ITPR1 antibody (ABIN4327442) Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

ProductDetails: References for anti-ITPR1 antibody (ABIN4327442)

Produktdetails anti-ITPR1 Antikörper Target Details ITPR1 Anwendungsinformationen Handhabung Bilder zurück nach oben
Produkt verwendet in:

Klar, Hisatsune, Baig, Tariq, Johansson, Rasool, Malik, Ameur, Sugiura, Feuk, Mikoshiba, Dahl: "Abolished InsP3R2 function inhibits sweat secretion in both humans and mice." in: The Journal of clinical investigation, Vol. 124, Issue 11, pp. 4773-80, 2014 (Probematerial (Species): Human). Weitere Details: Immunohistochemistry

Bilder

Produktdetails anti-ITPR1 Antikörper Target Details ITPR1 Anwendungsinformationen Handhabung ProductDetails: References for anti-ITPR1 antibody (ABIN4327442) zurück nach oben
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-ITPR1 Antikörper (Inositol 1,4,5-Trisphosphate Receptor, Type 1) (ABIN4327442) Immunohistochemistry: IP3R1 Antibody [NBP1-83104] - Staining of human cerebellum show...