anti-Human CTR9 Antikörper für Immunofluorescence

Recommended CTR9 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
RNA Polymerase-Associated Protein CTR9 Homolog (CTR9) Antikörper
  • p150
  • p150tsp
  • sh2bp1
  • tsbp
  • fc54a06
  • wu:fc54a06
  • SH2BP1
  • TSBP
  • p150TSP
  • Sh2bp1
  • AA409336
  • Tsbp
  • Tsp
  • mKIAA0155
  • Ctr9, Paf1/RNA polymerase II complex component, homolog
  • Ctr9, Paf1/RNA polymerase II complex component, homolog (S. cerevisiae)
  • RNA polymerase-associated protein CTR9 homolog
  • CTR9, Paf1/RNA polymerase II complex component
  • ctr9
  • CTR9
  • LOC100161197
  • LOC100163982
  • LOC100168634
  • LOC100478349
  • LOC100520661
  • LOC100543206
  • LOC100558984
  • LOC100645071
  • Ctr9
Reaktivität
Human
36
28
23
2
2
1
1
1
1
1
Wirt
Kaninchen
36
Klonalität
Polyklonal
Konjugat
Dieser CTR9 Antikörper ist unkonjugiert
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF)
22
13
9
8
6
4
2
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN5076125
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN261120 ICC IF IHC IHC (p) IP WB Rabbit AA 1123-1173 Anmelden zum Anzeigen Polyclonal
1 ABIN1978152 IF IHC (p) Rabbit IgG AA 1123-1173 Anmelden zum Anzeigen Polyclonal
1 ABIN2740184 ELISA IF IHC (p) WB Rabbit AA 1022-1056 Anmelden zum Anzeigen Polyclonal
1 ABIN2414845 IF IHC ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal

General

Antigen RNA Polymerase-Associated Protein CTR9 Homolog (CTR9) Antikörper
Reaktivität Human
(36), (28), (23), (2), (2), (1), (1), (1), (1), (1)
Wirt Kaninchen
(36)
Klonalität
Polyklonal
Konjugat Dieser CTR9 Antikörper ist unkonjugiert
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF)
(22), (13), (9), (8), (6), (4), (2), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-CTR9 Antikörper

Target Details CTR9 Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NILREHPNYVDCYLRLGAMARDKGNFYEASDWFKEALQINQDHPDAWSLIGNLHLAKQEWGPGQKKFERILKQPSTQSDTYSMLALGNVWLQT
Isotyp IgG

Target Details CTR9

Produktdetails anti-CTR9 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung CTR9 (CTR9 Antibody Abstract)
Hintergrund Gene Symbol: CTR9
Gen-ID 9646
Forschungsgebiet Transcription Factors, Chromatin and Nuclear Signaling
Pathways Cellular Response to Molecule of Bacterial Origin, Stem Cell Maintenance

Anwendungsinformationen

Produktdetails anti-CTR9 Antikörper Target Details CTR9 Handhabung Bilder zurück nach oben
Applikationshinweise Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-CTR9 Antikörper Target Details CTR9 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-CTR9 Antikörper Target Details CTR9 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunofluorescence (IF) image for anti-RNA Polymerase-Associated Protein CTR9 Homolog (CTR9) antibody (ABIN5076125) Immunocytochemistry/Immunofluorescence: CTR9 Antibody - Staining of human cell line ...