anti-Human Phosphoglycerate Kinase 1 Antikörper für Immunohistochemistry

Recommended Phosphoglycerate Kinase 1 Antibody (geliefert von: Anmelden zum Anzeigen )

Phosphoglycerate Kinase 1 (PGK1) Antikörper
  • PGK1
  • PGK
  • MIG10
  • PGKA
  • Pgk-1
  • Pgk
  • wu:fd59b07
  • wu:fj36g06
  • zgc:56252
  • zgc:77899
  • phosphoglycerate kinase 1
  • phosphoglycerate kinase 1
  • PGK1
  • LOC100348124
  • Pgk1
  • pgk1
Immunohistochemistry (IHC), Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren


Produktnummer ABIN629772
$ 388.93
Zzgl. Versandkosten $45.00
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
9.385416 ABIN3032223 IHC ELISA WB Rabbit Ig Fraction AA 305-334 Anmelden zum Anzeigen Polyclonal
9.385416 ABIN3032224 FACS IF IHC ELISA WB Rabbit Ig Fraction AA 117-145 Anmelden zum Anzeigen Polyclonal
9.385416 ABIN2429505 IHC ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
9.385416 ABIN2422891 IHC ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN2783240 IHC WB Rabbit C-Term Anmelden zum Anzeigen Polyclonal 1
1 ABIN4345073 ELISA ICC IF IHC IHC (p) WB Rabbit IgG Center Anmelden zum Anzeigen Polyclonal 1
1 ABIN2463141 IHC ELISA WB Rabbit Anmelden zum Anzeigen Polyclonal
1 ABIN1874110 IF IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN2626755 IHC WB Rabbit IgG AA 166-180 Anmelden zum Anzeigen Polyclonal
1 ABIN3022690 IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN4345072 IHC IHC (p) WB Rabbit C-Term Anmelden zum Anzeigen Polyclonal
1 ABIN1923245 IHC ELISA WB Alkaline Phosphatase (AP) Rabbit IgG Internal Region Anmelden zum Anzeigen Polyclonal
1 ABIN1923246 IHC ELISA WB APC Rabbit IgG Internal Region Anmelden zum Anzeigen Polyclonal
1 ABIN1923247 IHC ELISA WB PE Rabbit IgG Internal Region Anmelden zum Anzeigen Polyclonal
1 ABIN1957094 ELISA IHC IHC (p) WB FITC Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN1958203 ELISA IHC IHC (p) WB HRP Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN1923249 ELISA FACS ICC IF IHC WB APC Rabbit IgG AA 124-153 Anmelden zum Anzeigen Polyclonal
1 ABIN1923248 ELISA FACS ICC IF IHC WB Alkaline Phosphatase (AP) Rabbit IgG AA 124-153 Anmelden zum Anzeigen Polyclonal
1 ABIN1923250 ELISA FACS ICC IF IHC WB PE Rabbit IgG AA 124-153 Anmelden zum Anzeigen Polyclonal
1 ABIN5585578 ELISA IHC WB Mouse IgG1 Anmelden zum Anzeigen 14


Antigen Phosphoglycerate Kinase 1 (PGK1) Antikörper
Epitop C-Term
(21), (13), (11), (6), (6), (6), (4), (4), (3), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Reaktivität Human
(135), (68), (41), (5), (5), (4), (4), (4), (4), (4), (3), (3), (2), (2), (1), (1), (1), (1)
Wirt Kaninchen
(117), (17), (4), (1)
Konjugat Unkonjugiert
(8), (7), (7), (4), (4), (4), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunohistochemistry (IHC), Western Blotting (WB)
(115), (69), (52), (27), (22), (18), (13), (11), (7), (4), (3), (3), (3), (2), (1), (1)
Hersteller Anmelden zum Anzeigen


Antigendetails Anwendungsinformationen Handhabung Bilder
Spezifität PGK1 antibody was raised against the C terminal of PGK1
Reinigung Purified
Immunogen PGK1 antibody was raised using the C terminal of PGK1 corresponding to a region with amino acids ATVASGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFAR


Produktdetails Anwendungsinformationen Handhabung Bilder zurück nach oben
Andere Bezeichnung PGK1 (PGK1 Antibody Abstract)
Hintergrund PGK1 is a glycolytic enzyme that catalyzes the conversion of 1,3-diphosphoglycerate to 3-phosphoglycerate. The protein may also act as a cofactor for polymerase alpha.
Molekulargewicht 44 kDa (MW of target protein)
Forschungsgebiet Cancer, Metabolism, Proteases, Enzymes
Pathways Cellular Glucan Metabolic Process


Produktdetails Antigendetails Handhabung Bilder zurück nach oben
Applikationshinweise WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

PGK1 Blocking Peptide, catalog no. 33R-1574, is also available for use as a blocking control in assays to test for specificity of this PGK1 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails Antigendetails Anwendungsinformationen Bilder zurück nach oben
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGK1 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.


Produktdetails Antigendetails Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-Phosphoglycerate Kinase 1 (PGK1) (C-Term) antibody (ABIN629772) PGK1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to st...
Western Blotting (WB) image for anti-Phosphoglycerate Kinase 1 (PGK1) (C-Term) antibody (ABIN629772) PGK1 antibody used at 1.25 ug/ml to detect target protein.